DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li MW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li MW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-134311X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li MW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li MW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-134312X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li MW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Li MW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-134314X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li MW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Li MW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-134315X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Li MW., Mruk DD., Lee WM., Cheng CY. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Li MW., Mruk DD., Lee WM., Cheng CY. DIP original experiment: DIP-134313X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Connexin 43 and plakophilin-2 as a protein complex that regulates blood-testis barrier dynamics. cadh2_rat Cadherin-2 Cdh2 Neural cadherin protein protein rat Rattus norvegicus (Rat) Rat MCRIAGGPRTLLPLLAALLQASLEASGELALCKTGFPEDVYSAVLPKTVHEGQPLLNVKFSNCNRKRKVQYESSEPADFKVDEDGTVYAVRSFPLSAEQAKFLIYAQDKETQEKWQVAVNLSLEPSLTEEPMKEPHEIEEIVFPRQLAKHSGALQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTLTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPEPNSINITALDYDIDPNAGPFAFDLPLSPATIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIVITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGTIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRLDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPRFKKLADMYGGGDD DIP protein Q9Z1Y3 original sequence version: 78 DIP protein Q9Z1Y3 original sequence version: 94 ctnb1_rat Catenin beta-1 Ctnnb1 Catnb Beta-catenin protein protein rat Rattus norvegicus (Rat) Rat MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGPHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein Q9WU82 original sequence version: 140 DIP protein Q9WU82 original sequence version: 93 DIP protein Q9WU82 original sequence version: 115 9C29186B6DD54B87 src_rat Proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein rat Rattus norvegicus (Rat) Rat MGSNKSKPKDASQRRRSLEPAENVHGAGGAFPASQTPSKPASADGHRGPNAAFVPPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein Q9WUD9 original sequence version: 74 DIP protein Q9WUD9 original sequence version: 94 mint homomint 453D1E904EC660A3 cxb2_rat Gap junction beta-2 protein Gjb2 Cxn-26 Connexin-26 protein protein rat Rattus norvegicus (Rat) Rat MDWGTLQSILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMISVSGICILLNITELCYLFIRYCSGKSKRPV DIP protein P21994 original sequence version: 87 E36EC95F1B235A0D plakophilin2 Plakophilin 2 protein protein rat Rattus norvegicus (Rat) Rat cxa1_rat Gap junction alpha-1 protein Gja1 Cxn-43 Connexin-43 Gap junction 43 kDa heart protein protein protein rat Rattus norvegicus (Rat) Rat MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI DIP protein P08050 original sequence version: 110 DIP protein P08050 original sequence version: 147 0196416EA6A69490 gjb2-gja1-1 1 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 9 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association cdh2-gja1-1 3 6 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association ctnnb1-gja1-1 2 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 7 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association plakophilin2-gja1-1 4 10 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association src-gja1-1 5 8 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association