DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Selective engagement of G protein coupled receptor kinases (GRKs) encodes distinct functions of biased ligands. Selective engagement of G protein coupled receptor kinases (GRKs) encodes distinct functions of biased ligands. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Zidar DA., Violin JD., Whalen EJ., Lefkowitz RJ. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Zidar DA., Violin JD., Whalen EJ., Lefkowitz RJ. DIP original experiment: DIP-260325X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Selective engagement of G protein coupled receptor kinases (GRKs) encodes distinct functions of biased ligands. arrb2_rat Beta-arrestin-2 Arrb2 Arrestin beta-2 protein protein rat Rattus norvegicus (Rat) Rat MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAPREIDIPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDCDDQFC DIP protein P29067 original sequence version: 115 DIP protein P29067 original sequence version: 112 DIP protein P29067 original sequence version: 100 0DFA6A897C2B86BA ccr7_human C-C chemokine receptor type 7 CCR7 CMKBR7 EBI1 EVI1 BLR2 CDw197 Epstein-Barr virus-induced G-protein coupled receptor 1 MIP-3 beta receptor protein protein human Homo sapiens Human MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP DIP protein P32248 original sequence version: 139 D4CB4213841A1BD4 ccr7-arrb2-1 1 3 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 2 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction