DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132646X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132643X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132645X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132644X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132641X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. PLoS biology 2009 imex curation Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shan Y., Yu L., Li Y., Pan Y., Zhang Q., Wang F., Chen J., Zhu X. DIP original experiment: DIP-132642X PLoS biology 2009 IMEx Nudel and FAK as antagonizing strength modulators of nascent adhesions through paxillin. p49023-2 Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023-2 original sequence version: 92 DIP protein P49023-2 original sequence version: 115 94A6C321E4735076 paxi_human Paxillin PXN protein protein human Homo sapiens Human MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC DIP protein P49023 original sequence version: 115 DIP protein P49023 original sequence version: 126 DIP protein P49023 original sequence version: 169 DIP protein P49023 original sequence version: 140 DIP protein P49023 original sequence version: 175 ABF6C0BE5939623F p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF vinc_human Vinculin Metavinculin VCL protein protein human Homo sapiens Human MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ DIP protein P18206 original sequence version: 126 BFBD687DA836B0FA ndel1_human Nuclear distribution protein nudE-like 1 NDEL1 Mitosin-associated protein 1 EOPA MITAP1 NUDEL protein protein human Homo sapiens Human MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV DIP protein Q9GZM8 original sequence version: 36 DIP protein Q9GZM8 original sequence version: 65 DIP protein Q9GZM8 original sequence version: 78 E91EA053FCA315D7 ndel1-pxn-1 5 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association pxn-ndel1-1 2 7 unspecified role unspecified role bait bait Region 324-557 Region 324-557 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 11 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ndel1-pxn-2 3 10 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association ndel1-pxn-3 6 7 unspecified role unspecified role prey prey Region 324-557 Region 324-557 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association ndel1-pxn-4 4 7 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ndel1-cdc42-1 1 9 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 7 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association