DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. DIP original experiment: DIP-260319X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. DIP original experiment: DIP-260318X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Hubert DA., He Y., McNulty BC., Tornero P., Dangl JL. DIP original experiment: DIP-260320X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Specific Arabidopsis HSP90.2 alleles recapitulate RAR1 cochaperone function in plant NB-LRR disease resistance protein regulation. rar1_arath Cysteine and histidine-rich domain-containing protein RAR1 RAR1 At5g51700 PBS2 RPR2 AtRAR1 CHORD domain-containing protein RAR1 Protein PPHB SUSCEPTIBLE 2 Protein REQUIRED FOR MLA12 RESISTANCE 1 MIO24.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV DIP protein Q9SE33 original sequence version: 69 DIP protein Q9SE33 original sequence version: 61 F8F9D30B9BF3A51E sgt1b_arath Protein SGT1 homolog B SGT1B EDM1 ETA3 At4g11260 RPR1 Protein ENHANCED DOWNY MILDEW 1 Protein ENHANCER OF TIR1-1 AUXIN RESISTANCE 3 Suppressor of G2 allele of SKP1 homolog B F8L21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDANKAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPSLPSSSTTPLATEADAPPVPIPAAPAKPMFRHEFYQKPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKKQEKDEKLDGDAAMNKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY DIP protein Q9SUT5 original sequence version: 121 DIP protein Q9SUT5 original sequence version: 111 711172817DD349C3 hs902_arath Heat shock protein 90-2 HSP90-2 ERD8 HSP81-2 LRA2 Heat shock protein 81-2 Protein EARLY-RESPONSIVE TO DEHYDRATION 8 Protein LOSS OF RECOGNITION OF AVRRPM1 2 MUSE12 Protein MUTANT SNC1-ENHANCING 12 MDA7.7 At5g56030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWIEKTIEKEISDDEEEEEKKDEEGKVEEVDEEKEKEEKKKKKIKEVSHEWDLVNKQKPIWMRKPEEINKEEYAAFYKSLSNDWEEHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDTKKKPNNIKLYVRRVFIMDNCEDIIPEYLGFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKAVENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDDAVEADAEMPPLEDDADAEGSKMEEVD DIP protein P55737 original sequence version: 109 78A6E490AE48E508 rar1-hsp90_2-4 2 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey P55737:p.Ala42Thr A42T mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A42T'. Wed May 02 14:30:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala42thr' Tue Jun 30 16:59:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala42Thr' P55737:p.Asp80Asn D80N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D80N'. Wed May 02 15:37:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp80asn' Tue Jun 30 19:48:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp80Asn' P55737:p.Arg337Cys R337C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R337C'. Wed May 02 19:54:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg337cys' Tue Jun 30 18:06:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg337Cys' P55737:p.Gly95Glu G95E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G95E'. Wed May 02 17:41:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly95glu' Tue Jun 30 17:21:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly95Glu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hsp90_2-1 3 6 unspecified role unspecified role unspecified role unspecified role P55737:p.Ala42Thr A42T mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A42T'. Wed May 02 18:32:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala42thr' Tue Jun 30 16:54:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala42Thr' P55737:p.Asp80Asn D80N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D80N'. Wed May 02 17:33:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp80asn' Tue Jun 30 18:10:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp80Asn' P55737:p.Ser100Phe S100F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S F This feature has been corrected as a result of our quality control procedures. The original label was 'S100F'. Wed May 02 14:41:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser100phe' Tue Jun 30 18:30:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser100Phe' P55737:p.Gly95Glu G95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G95E'. Wed May 02 14:45:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly95glu' Tue Jun 30 15:39:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly95Glu' P55737:p.Ala11Thr A11T mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A11T'. Wed May 02 19:37:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala11thr' Tue Jun 30 17:23:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala11Thr' P55737:p.Arg337Cys R337C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R337C'. Wed May 02 17:36:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg337cys' Tue Jun 30 17:51:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg337Cys' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction sgt1b-hsp90_2-1 1 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey P55737:p.Ala42Thr A42T mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain A T This feature has been corrected as a result of our quality control procedures. The original label was 'A42T'. Wed May 02 16:04:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala42thr' Tue Jun 30 19:30:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala42Thr' P55737:p.Asp80Asn D80N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D N This feature has been corrected as a result of our quality control procedures. The original label was 'D80N'. Wed May 02 18:04:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp80asn' Tue Jun 30 19:53:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp80Asn' P55737:p.Gly95Glu G95E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G95E'. Wed May 02 16:27:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly95glu' Tue Jun 30 16:52:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly95Glu' P55737:p.Arg337Cys R337C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R337C'. Wed May 02 14:38:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg337cys' Tue Jun 30 18:54:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg337Cys' P55737:p.Ser100Phe S100F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S F This feature has been corrected as a result of our quality control procedures. The original label was 'S100F'. Wed May 02 17:45:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser100phe' Tue Jun 30 17:23:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser100Phe' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association