DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu NTRC links built-in thioredoxin to light and sucrose in regulating starch synthesis in chloroplasts and amyloplasts. NTRC links built-in thioredoxin to light and sucrose in regulating starch synthesis in chloroplasts and amyloplasts. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Michalska J., Zauber H., Buchanan BB., Cejudo FJ., Geigenberger P. Only protein-protein interactions in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay predetermined predetermined participant predetermined Michalska J., Zauber H., Buchanan BB., Cejudo FJ., Geigenberger P. DIP original experiment: DIP-260301X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx NTRC links built-in thioredoxin to light and sucrose in regulating starch synthesis in chloroplasts and amyloplasts. ntrc_orysj Thioredoxin reductase NTRC NADPH-dependent thioredoxin reductase C OsJ_25429 LOC_Os07g46410 Os07g0657900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MAVTRLAVAAALSAAPPSSRRRRAFFHHSCRPLPSSAAAAAKALRASAAPAVDEEAPASPPPSDLGKGVENLVIIGSGPAGYTAAIYAARANLKPVVFEGYQVGGVPGGQLMTTTEVENFPGFPDGVTGPDLMDKMRKQAERWGAELHQEDVEFVNVKSRPFVIRSSDREVKCHSVIIATGAAAKRLRLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKYARHVHLLVRKDQLRASKAMQDRVLNNPNITVHFNTEAVDVVSNPKGQMSGIQLKRTDTGEESVLEVKGLFYGIGHTPNSQLLQGQIDLDDAGYILVEEGTAKTSVDGVFAAGDVQDHEWRQAVTAAGSGCVAALSVERYLVANDLLVEFHQPVREEKEKEITDRDVEMGFDISHTKHRGQYALRKVYHESPRLVCVLYTSPTCGPCRTLKPILSKVIDEYNEHVHFVEIDIEEDPEIAEAAGIMGTPCVQFFKNKEMLRTVSGVKMKKEYREFIESNK DIP protein Q70G58 original sequence version: 75 mint C10BF4681B135DA3 q43836_soltu AGPB1 protein protein soltu Solanum tuberosum (Potato) Potato MAASIGALKSSPSSNNCINERRNDSTRAVSSRNLSFSSSHLAGDKLMPVSSLRSKGVRFNVRRSPLIMSPKAVSDSQNSQTCLDPDASR DIP protein Q43836 original sequence version: 37 agpb1-ntrc_orysj-1 1 2 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 3 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction