DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Román-Hernández G., Grant RA., Sauer RT., Baker TA. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Román-Hernández G., Grant RA., Sauer RT., Baker TA. DIP original experiment: DIP-134254X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Román-Hernández G., Grant RA., Sauer RT., Baker TA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Román-Hernández G., Grant RA., Sauer RT., Baker TA. DIP original experiment: DIP-134253X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Molecular basis of substrate selection by the N-end rule adaptor protein ClpS. clps_cauvc ATP-dependent Clp protease adapter protein ClpS clpS CC_2467 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MICPPGENKSMAERKQGGQGNGVGSSVVTEVKPKTQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD B255057D2EFD433C wpeptide Tryptophane peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) WLYVQRDSKE lpeptide Leucine peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LLYVQRDSKEC clps-wpeptide-1 2 4 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 3 unspecified role unspecified role unspecified role unspecified role Region 35-119 Region 35-119 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction clps-lpeptide-1 1 5 unspecified role unspecified role unspecified role unspecified role Fluorescein-maleamide-label Fluorescein-maleamide-label fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role unspecified role unspecified role Region 35-119 Region 35-119 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction