DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. DIP original experiment: DIP-134236X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. DIP original experiment: DIP-134237X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. DIP original experiment: DIP-134235X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Van den Broeke C., Radu M., Deruelle M., Nauwynck H., Hofmann C., Jaffer ZM., Chernoff J., Favoreel HW. DIP original experiment: DIP-134238X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Alphaherpesvirus US3-mediated reorganization of the actin cytoskeleton is mediated by group A p21-activated kinases. q5pp90_9alph US3(L) protein protein pseudorabies virus pseudorabies virus MLAMWRWVTKRSRLRRGHAHLGGNKGVRGICSLYLAGLSRGLSRVHAQRSHAATMADAGIPDEILYSDISDDEIIIDGDGDSSGDEDDDDGGLTRQAAARIVTDLGFEVLQPLQSGSEGRVFVARRPGEADTVVLKVGQKPSTLMEGMLLQRLSHDNVMRMKQMLARGPATCLVLPHFRCDLYSYLTMRDGPLDMRDAGCVIRAVLRGLAYLHGMRIMHRDVKAENIFLEDVDTVCLGDLGAARCNVAAPNFYGLAGTIETNAPEVLARDRYDTKVDVWGAGVVLFETLAYPKTITGGDEPAINGEMHLIDLIRALGVHPEEFPPDTRLRSEFVRYAGTHRQPYTQYARVARLGLPETGAFLIYKMLTFDPVRRPSADEILNFGMWTV DIP protein Q5PP90 original sequence version: 35 pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR DIP protein Q13177 original sequence version: 166 DIP protein Q13177 original sequence version: 114 00A7CD15F93D4180 pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B pak2-us3(l)-1 3 6 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation us3(l)-pak1-1 4 7 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction pak1-us3(l)-1 1 7 enzyme target enzyme target substrate substrate unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 5 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation us3(l)-pak2-1 2 6 unspecified role unspecified role prey prey ecolx Escherichia coli 5 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction