DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134133X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134135X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134145X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134139X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134149X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134137X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134140X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134141X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134138X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134147X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134132X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134148X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134136X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134150X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134142X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134146X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134144X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134134X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Uehara R., Nozawa RS., Tomioka A., Petry S., Vale RD., Obuse C., Goshima G. DIP original experiment: DIP-134143X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells. dgt4_drome Augmin complex subunit dgt4 dgt4 Dim gamma-tubulin 4 CG4865 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly METPPTPTTTTPPSLTTEGTMDDIQYLLHLEAMRRFQEDSRNVKRQVEEQVRIWLDAKCEYQRDFGRLARLLKCGALQAAVDAHRVSDVNQVDQAAKDIASLRSKLGSDLRPAILDSNDVKQCLEHLNTTHKPRLNLCRQQREFAQNQEALRSLRTAVDGLENGMEMGMIQAMDRLVEDLLPPRETNN DIP protein Q9W4M8 original sequence version: 65 D65D8B0C0A250F7E haus6_human HAUS augmin-like complex subunit 6 HAUS6 DGT6 FAM29A KIAA1574 protein protein human Homo sapiens Human MSSASVTAFEKEHLWMYLQALGFEPGPATIACGKIVSHTHLGVNMFDKLNRDAFHIISYFLFQVLDQSLTKEVFKFCWPPFDQKSDTEFRKHCCEWIKRISGECGSSFPQVVGSLFLSPGGPKFIHLMYHFARFVAMKYIKSNSKNSSHHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVNETLMFLEKEREVVSSVLSLVNQYALDGTNVAINIPRLLLDKIEKQMFQLHIGNVYEAGKLNLLTVIQLLNEVLKVMKYERCQADQARLTVDLHYLEKETKFQKERLSDLKHMRYRIKDDLTTIRHSVVEKQGEWHKKWKEFLGLSPFSLIKGWTPSVDLLPPMSPLSFDPASEEVYAKSILCQYPASLPDAHKQHNQENGCRGDSDTLGALHDLANSPASFLSQSVSSSDRNSVTVLEKDTKMGTPKEKNEAISKKIPEFEVENSPLSDVAKNTESSAFGGSLPAKKSDPFQKEQDHLVEEVARAVLSDSPQLSEGKEIKLEELIDSLGSNPFLTRNQIPRTPENLITEIRSSWRKAIEMEENRTKEPIQMDAEHREVLPESLPVLHNQREFSMADFLLETTVSDFGQSHLTEEKVISDCECVPQKHVLTSHIDEPPTQNQSDLLNKKVICKQDLECLAFTKLSETSRMETFSPAVGNRIDVMGGSEEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGISSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEANFKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTDDTLNFLDTCDLHTEHIKPSLRTSIGERKRSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLTR DIP protein Q7Z4H7 original sequence version: 60 DIP protein Q7Z4H7-1 original sequence version: 95 8EA52C24BA818C00 dgt3_drome Augmin complex subunit dgt3 dgt3 Dim gamma-tubulin 3 CG3221 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGDLLSNSEFFKKLGVDSSNQWILYDEQMEMFFKFLSGNITDANILTERQVLEREEMQRRGEWLSASDRELKLLQIEAESPGLLNYKQQDVDALTMSIEAIEDASRDYATLLEDMMTTKHSITKHLGEVECVTAELQLREKDLIAECQSKAKQLEELQQENCRLSAEAKKAFTAPQLPPLFMHQLPLEQYFHKCDSFMQYFTLYVKENFKIQDYDEFQSAEEDLGREKAKLEDLERGIQFYALSYIRTKAKVKATQCLIDQLDLGKIHCLSLTDMAREMHDLQLLNDYQLSNTHDTLLNDLTIHIQQHTQRRIELVLYENTKLKLERAVRRHESDKKLTKIISDALSNAELLWIAIQLDCDKKRNCLDTSEELRDQAQATWQRIQTMRSINASYQGICAQFVQEIANLLSAHLGQNIKATEAKACLFEYEKFGRLLSYSFQSMLNRKSCAAVQDQLAELKRLEQTLRPFVYDSPLEQPMFENVRYLSAIYNVTQQQTRLDESGRSLRKDFLENVVGRIERDKLYRYSVVLWIWFLTEPQRMMHAIDEVKKAAAAVIRPGGGLHRK DIP protein Q9W2P0 original sequence version: 60 13D1E05627568E53 haus2_human HAUS augmin-like complex subunit 2 HAUS2 C15orf25 CEP27 Centrosomal protein of 27 kDa protein protein human Homo sapiens Human MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK DIP protein Q9NVX0 original sequence version: 62 DIP protein Q9NVX0-1 original sequence version: 100 E1475D00313FCA7F haus1_human HAUS augmin-like complex subunit 1 HAUS1 CCDC5 HEIC Coiled-coil domain-containing protein 5 Enhancer of invasion-cluster protein protein human Homo sapiens Human MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL DIP protein Q96CS2 original sequence version: 69 DIP protein Q96CS2-1 original sequence version: 108 06F6A1B9FCF0698A haus4_human HAUS augmin-like complex subunit 4 HAUS4 C14orf94 protein protein human Homo sapiens Human MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKEVRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLLGLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQQQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLRMEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATENKRWALQEFSKVYR DIP protein Q9H6D7 original sequence version: 68 DIP protein Q9H6D7-1 original sequence version: 103 AAAFA1FFC25189C0 haus3_human HAUS augmin-like complex subunit 3 HAUS3 C4orf15 protein protein human Homo sapiens Human MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED DIP protein Q68CZ6 original sequence version: 46 DIP protein Q68CZ6 original sequence version: 81 C65B80CC58F326E9 rbm7_human RNA-binding protein 7 RNA-binding motif protein 7 RBM7 protein protein human Homo sapiens Human MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH DIP protein Q9Y580 original sequence version: 86 31D344EBFC54B22F dgt5_drome Augmin complex subunit dgt5 Dim gamma-tubulin 5 CG8828 dgt5 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAYQEKITEFKNWATNLGCPPTALPTDDALRRIFKSGSSLLLNQLQSRIQPVDYVREVRENLLIAQVARYKDKMVPLASRSFQPPELQRYQKIQELKKHKEKANQQLTEARKEYQKLSAGIKTKNIQTISAENRKQLLESKCNILDLKLESLNKNYDQELKNKIQILGTTPVKLSARNASEAQATRAVEQALKQLETFYGMCDDGNAVNNLAEAKQRLWDQMRSTFADIPNSLLLNVVMKIKEEQLQHIMKLNESRGECTNDKPPLNNYEVKLLKTKADMLGLAAKYFAAQKELELKEERFCQDYSVFVDKLQSKVYRFNGISLGDEENADELISDYLVQYNMRNFNRSQNEFLREQIEQLRLELDAGAKQLENHDLKLGSVKQVYGDINSSINRIQQDMVQLSQIKEKILFSRNMMKNLLDDMQAATQKQNAKSQLMSTKLKVSNMSMLGAESFCLANDSVFSSTKVEFDGNCSAINSTMRRSFDNKTLVPGGAASTTLMAASGATLPSHLLEFNTFLEIPLEKFSCTPRACSFLLSANPLIVEAQELASTVQLAPGYLLTPFGALQEVRKRILWASAIAAHTSELKLNLQPLIVDPHDLRLKASRQHEEIDQLLDNLMAIGVKTQLQLEKAERIYQFLLENPLRRYVPPSKRYNNGSFADYESEFNLYYRMTTNGSSMRAPPN DIP protein Q7K4B4 original sequence version: 36 4808C2FDEF7E3A91 nedd1_human Protein NEDD1 Neural precursor cell expressed developmentally down-regulated protein 1 NEDD1 protein protein human Homo sapiens Human MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIATVLPQPMTSAMGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVNKGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGKQESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF DIP protein Q8NHV4 original sequence version: 69 12817A567C13098B msd5_drome Augmin complex subunit msd5 msd5 Mitotic spindle density protein 5 dgt7 CG2213 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly METNVDFSSISSKLYRKYAQHVRNLKDVCVSKTVMKPGAFFDSLQQMMEEEAAATTPPRDLSSVADYAELFKTLEEYPANLQKMPKKRELQRTNSTLLRGADESVAMGINTSNVSLSLTRLEEQRSAVDVYNDFKGFQRKLAKIYDEAAALDTTESIYKQKLTQLHGFAQQLEKLMPTGGESPPDAFTSEQQEKLLTIAANMEQLNYLRSNSLQLPNPNEILATGSLAARLEMFVEVLTYTLLQVSSYNMAMI DIP protein Q9W0G6 original sequence version: 63 6F1CC76D68802740 haus7_human HAUS augmin-like complex subunit 7 HAUS7 26S proteasome-associated UCH37-interacting protein 1 X-linked protein STS1769 UIP1 UCHL5IP UCHL5-interacting protein protein protein human Homo sapiens Human MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK DIP protein Q99871 original sequence version: 61 DIP protein Q99871-1 original sequence version: 113 15E9A47D741DB26B dgt2_drome Augmin complex subunit dgt2 dgt2 Dim gamma-tubulin 2 CG16969 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDDPSATLLPEHSEDLRLARDAELKKVLKLKLVLDELRRLDVGPNPSDEIKRALKLVSIGSYARLGEMEGAGQEQVLGLPSGSSFPPLNYTDRKTVRTKLSAQLRTTLQPIAELCDRIREEFPDAFGQEADLSCDQKEILRLEEEHRSGLEKLVALLTRKCTLLKETAELKLGPQLANELKLQQAQAQLVQTKAELLRGFFVHEAASRTEHSVKAHKEVEAHLDELLAAKK DIP protein Q9VKD6 original sequence version: 66 09D0C4E25B10AE60 wagc_drome Augmin complex subunit wac wac dgt8 wee Augmin component CG13879 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQNLKIQEEVNSLMRLGQHFDDQLKLASVELGDFSDDDLALLDKCAQYYSLLHIHDINLNYLRDFYCAKKRECIENRQTTVQQRVELQRILSSIEEATRDVVMLERFNAAAEERLIPDIVVMQRNAQQLATKQALLDRQKTLKIPKDFSIESVIEKVDSLEQR DIP protein Q9W0S8 original sequence version: 61 B0C2372BD98E8A9F dgt6_drome Augmin complex subunit dgt6 dgt6 Dim gamma-tubulin 6 CG11881 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRTIIAPWKAEEKEQSEKLHRKLQGLALVHPLPDELRKLIAWDMFLKPNQVAFVHVMHYLFRLLDPAEFKRRFFWPITDKKSEANFRSSTVEYLKHLNEKHQLHWANIKSYLVVMPGGMRFINFLLEFVGFVIQELIKQREKSLGLEAGTPNVSAKVMARQNAVMKEYASSYVVNLEENTALLRDKTQKIRRLMADLSADMGVPEEQLADDGFLDEFEATAALGVERVITQPTERKFDLEASLCGLKEAIDLFQVKQAENNQSKEAVEKALRGMRVLFDCDAVTEGDFYDPLGASKMDALLNGFNRISGTIAEQLDANDHYNESNAFVTTDLQALRVELSQSEVQLNNLLKKLNEPSKKDKGSANASGSARVQTLQPATPRFESVISSKFVSTPPIRIDMGGGGGRNAPVRLALQDDFNGKQFDALSNSLLAPAPPRSARKLKALDQSTGIDLNGTLNRSKINDPMQMLRTIHKNTSKVKAAPQANLSSLGSKWKQMQASFGFDEAPVPGAAVISPQTSPTDPSDPFTPLSGSECTRIERIPRTSENNTSLIAKSAAVIKVLEVSRNVLNLSTSPSGRLDALVPHTESHQQDVAPRLQLNDRTINDSLQLDPDFNIENDKNAFNVSHKFDFDQIGGEDDLQNISDSVLKDIIF DIP protein Q9VAP2 original sequence version: 67 3F78AED5E3D72F7E haus5_human HAUS augmin-like complex subunit 5 HAUS5 KIAA0841 protein protein human Homo sapiens Human MELAQEARELGCWAVEEMGVPVAARAPESTLRRLCLGQGADIWAYILQHVHSQRTVKKIRGNLLWYGHQDSPQVRRKLELEAAVTRLRAEIQELDQSLELMERDTEAQDTAMEQARQHTQDTQRRALLLRAQAGAMRRQQHTLRDPMQRLQNQLRRLQDMERKAKVDVTFGSLTSAALGLEPVVLRDVRTACTLRAQFLQNLLLPQAKRGSLPTPHDDHFGTSYQQWLSSVETLLTNHPPGHVLAALEHLAAEREAEIRSLCSGDGLGDTEISRPQAPDQSDSSQTLPSMVHLIQEGWRTVGVLVSQRSTLLKERQVLTQRLQGLVEEVERRVLGSSERQVLILGLRRCCLWTELKALHDQSQELQDAAGHRQLLLRELQAKQQRILHWRQLVEETQEQVRLLIKGNSASKTRLCRSPGEVLALVQRKVVPTFEAVAPQSRELLRCLEEEVRHLPHILLGTLLRHRPGELKPLPTVLPSIHQLHPASPRGSSFIALSHKLGLPPGKASELLLPAAASLRQDLLLLQDQRSLWCWDLLHMKTSLPPGLPTQELLQIQASQEKQQKENLGQALKRLEKLLKQALERIPELQGIVGDWWEQPGQAALSEELCQGLSLPQWRLRWVQAQGALQKLCS DIP protein O94927 original sequence version: 64 DIP protein O94927-1 original sequence version: 102 23D8746F2A81ABCB ybox3_human Y-box-binding protein 3 YBX3 CSDA Cold shock domain-containing protein A DBPA DNA-binding protein A Single-strand DNA-binding protein NF-GMB protein protein human Homo sapiens Human MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE DIP protein P16989 original sequence version: 113 AA8517AC3B7D35CC msd1_drome Augmin complex subunit msd1 msd1 dgt9 CG13914 Mitotic spindle density protein 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDAVDKMLAGMAANRQTMNRQLAKIDEIMERSNNTLLHIESNSKAFSQNVALSETQKMYNLRPEAEMTLSKILENFKLLMSSSDQREETYSALEGCLAYRHRVEHLGSSVRKLVALYDTVGQMKNSQEEQYASEDSP DIP protein Q9W0G7 original sequence version: 52 flot1_drome Flotillin-1 Flo Flo-1 CG8200 Flo1 FLODM-1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIARSVHAG DIP protein O61491 original sequence version: 84 64C99F9CB4676C0C q86lc4_drome Grip71 CG10346 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHVISTSKKTVLSDFADLETKSEYVHQNAEPTDFQFNGQRRVFVEVDKMAGLAVMRIKEKDGKTPEIQRVRKLTIDNAFCVACAKQSLEEIAVGQSGCVKLYNFRTAQLIHRFPADPQRSTVLYMDYNNTDEYIAAVRDGGDISILGTKTKQKTNTFTIDGDSTLVRFHPSKRFHLSIASYKGAVTVYDVQGMRKIFHASEAHSAPCRDISMCTSQPALLVSVGYDCKINIFDIRRNRAQASTDRLTYSHPLSTVALSECGTYLCAGNLKGELIAYDMRSTKAPLAVRSVHDAAVTRVAFVPVPSGDNQQNGSLNSSENATGLATEAPRVERAPSDELRKSIAANLLSTQNQLTSLGYGVSTPTIVRRDSFCEFLDAQGPRAVDRMSTRLGASYRDSFDWETLNRKPQPYETANRQSLCPPVASGPSSVDNSVNSSTTESLQQTLSGPLKDRSNISGDGKLMKIAETDELCEEQSANISVASSTGGGSDKENPPPVDAEMKRRLRLLSASRNSTPHHANITPQSSNPLLKPQQLLAKSSSGLSAQMDADWRKEFSELRDFVDQRCEKVERELEYVTFSNQRLLANKVTNYMDQQVENTREIRDALALLLQGDSFMREFSRLQNENEMLKAKLKFYQEQEQTESCGE DIP protein Q86LC4 original sequence version: 52 978C881C2B065487 modu_drome DNA-binding protein modulo mod CG2050 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAQKKAVTVKGKKATNGEEKPLAKRVTKSTKVQEEETVVPQSPSKKSRKQPVKEVPQFSEEDESDVEEQNDEQPGDDSDFETEEAAGLIDDEAEEDEEYNSDDEEDDDDDELEPGEVSKSEGADEVDESDDDEEAPVEKPVSKKSEKANSEKSEENRGIPKVKVGKIPLGTPKNQIVFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKSVLIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKEENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPRAFVRLASVDDIPKALKLHSTELFSRFITVRRISQESISRTSELTLVVENVGKHESYSSDALEKIFKKFGDVEEIDVVCSKAVLAFVTFKQSDAATKALAQLDGKTVNKFEWKLHRFERSTSGRAILVTNLTSDATEADLRKVFNDSGEIESIIMLGQKAVVKFKDDEGFCKSFLANESIVNNAPIFIEPNSLLKHRLLKKRLAIGQTRAPRKFQKDTKPNFGKKPFNKRPAQENGGKSFVKRARF DIP protein P13469 original sequence version: 101 E5E383B2A0595E2E epb41_drome Protein 4.1 homolog cora CG11949 Protein coracle protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPAEIKPSAPAEPETPTKSKPKSSSSSHGKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAESTNTPVDRTPPKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSRSPIKNKKEKDADKEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAVNGNDELNDSNKSDKSSGRRGVGIFSSGRKSKSGSPSKDGKDKSGKDKDKEVGRLGLVVTSGLGDNQQDQNLDEAARNAAKNRGSTTPGVTRQYEYAVDNDGNTSPTRKSYTPGGFRYDQDPNSRKSGADGQEQLSPTSQQKKIGLAFNYAPGNENALKETAEKLKAGQLSPRTQDKLNRGQLSPKSRAKLLQDPLLSPTTRAKLQGSAVDAAAVPLSDSQKRSYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYVGPSKADVAAGLAGAAGSKKPGSPTKTGKGAPGAAAAAAAGAAGAAAAAAKPKKRRVKIMVITSKFDPSTKRIDAENGSIEHSTGILDPATGLIDTKYGVIDPKKGTLEALNTKTGKKEVFQGDVDGKTGNLHLVSGVADPKTGRLDDTLGQIVCITPQDNPVVELTVITSRIDPATGKIDTVNGDVERSLGVLNLDTGLLDTKYGEINTRTGELKAIDPKSGKIVVSKNVKVDPGTGQITILGIVDPKTNKIDPNQGRLIEVGQQIDPIVEVTSLAGKFDSKRNIIDPKTAQVETSGGQFDPKAGKIDTKYGQIDLVKHTITFNDPKSGKTVTRDIKIEPTTGQIVLKNQVNPKNNKPDKDYARIISLRIVQQRVDPATKAPITEVSASKDKDIVVDPKSNQIWVPTGATDPATKEQQYISSSVDPKTGYVITIYGYLDPKTNEIKKQTKLDPNTIKIEPTSGKIYTATGEVDQATGEPLYAATQVDPESGEVYTKLARVDPKTGKIVIVRILLISKTDERGRPEEIDPSTCEIDPVSGRVLKFFNKTVYVYNMIDPVTGEIVQVDPNDPRFAGARTTVTHTMTLTGEIDPVTGRIKSEYGDIDPNTGDIDPATAVTDPVTGKLILNYAQIDPSHFGKQAQVQTTTETVPITRQQFFDGVKHISKGALRRDSEGSSDDDMTAQYGADQVNEILIGSPAGQAGGKLGKPVSTPTVVKTTTKQVLTKNIDGVTHNVEEEVRNLGTGEVTYSTQEHKADATPTDLSGAYVTATAVTTRTATTHEDLGKNAKTEQLEEKTVATTRTHDPNKQQQRVVTQEVKTTATVTSGDQYQRRDSVSSTSSGDSGTPIDGPYDGASVVRTDNQKSPLFTTSATTGPHVESTRVVLGEDTPGFSGHGEIISTQTVSSKTRTVETITYKTERDGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQQTQ DIP protein Q9V8R9 original sequence version: 89 93940FC4F1ACEB83 q9vp57_drome pzg Z4 Dmel\CG7752 Pzg Q9VP57_DROME p160 z4 Dmel_CG7752 CG7752 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNNQLNPATYRKFNNLLSSGAVTVTGPSQPRILKSTRMVVPGGGGGGGASAGGASAVGGVAQQQAVNDAESGGVGIGGLATRCYICDDRCEPQTSLTDMCTTHTSTKFPNKLAQLVGEGFLVIVCGEDYVCSRCTNLVNYYDRLENDVERVKTNLISLLNKKYAINEDMGQEGSPPLKMQKMVGGSANRSLEESPSADLLRPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATKIYKCTSCDYKTSDMRLFNTHYETCKQQTFQCKTCRKIFPHFGAMKQHMVRDHNTAMDNTCAMCHINFVNENSLRKHMETNHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFKSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNFFKCGTCSMTFPKREMLVKHFEVHQSPSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNIRFFSCSICSLTFIQETYYNHHMETHRRDKKATSAGATALNSAATALLSDEPGEATGKAGDESGEQNAEADIESLFEKLHSDKNESGEAPKPGSKGGEMVITSQEGSGGITFNITIPQPDGDQSQKDSPNTTAPVSVSIDMPNLDQAEDESQSQGSIDAKGESGEASSADSKSNAAPVSMPSLDDDNEAAAAEAEASEETKTASKAGQEKAKAKAGESAKSKEAAAAEEPQPSDEGDVVAKREATDTPTTESEANATTAEAGESGEGEVTASTGAEGEAGEAAGGEHVAMELDEAMQAQVEGGQIKFIVNENGHLLQLDNHILTDAEGNQIIVQDPEQIQQLLQSVGVLQSGEGLEGETLQMMTDGSGQMVLVHGDNNEQQLIDASLLNSEGQLIIQQGQDGEEGAHVISEDGTRIPVSVSYTEDGQPIVQVQQQVLEAAQQAASASGGADDKEAAADSAGEEVQVSEASSGTASTTVVATSTASSTGGPSGGSFFALEEFTETKTD DIP protein Q9VP57 original sequence version: 92 CBD8387902B20336 haus8_human HAUS augmin-like complex subunit 8 HICE1 HEC1/NDC80-interacting centrosome-associated protein 1 Sarcoma antigen NY-SAR-48 HAUS8 protein protein human Homo sapiens Human MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSPDLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS DIP protein Q9BT25 original sequence version: 50 DIP protein Q9BT25-1 original sequence version: 85 05D7B175523E5DA5 haus6-nedd1-1 16 29 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role bait bait Region 480-955 Region 480-955 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association wac-dgt6-1 18 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 34 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association dgt2-cora-1 11 38 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 42 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 33 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 41 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 30 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 20 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 40 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 37 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 22 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 32 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 34 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 28 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association haus8-haus6-1 8 43 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association msd1-dgt6-1 2 37 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 34 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association nedd1-haus6-1 3 29 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q8NHV4:p.Ser411Ala S411A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S411A'. Wed May 02 16:02:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser411ala' Tue Jun 30 17:54:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser411Ala' human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus5-haus6-1 9 35 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus1-haus6-1 15 24 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus1-haus2-1 12 25 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 23 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 24 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 43 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 26 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 31 unspecified role unspecified role unspecified role unspecified role HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association grip71-dgt6-1 13 39 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 34 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association haus6-haus8-1 14 43 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction haus7-haus6-1 4 31 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus2-haus6-1 19 23 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus3-haus6-1 7 26 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association haus2-haus6-2 10 23 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey Region 1-438 Region 1-438 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association haus8-haus6-2 5 43 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction haus6-haus1-1 6 36 unspecified role unspecified role prey prey human Homo sapiens Human 25 unspecified role unspecified role prey prey human Homo sapiens Human 23 unspecified role unspecified role prey prey human Homo sapiens Human 24 unspecified role unspecified role prey prey human Homo sapiens Human 43 unspecified role unspecified role prey prey human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human 26 unspecified role unspecified role prey prey human Homo sapiens Human 31 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role prey prey human Homo sapiens Human 21 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association msd5-dgt6-1 1 30 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 34 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association haus4-haus6-1 17 25 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 21 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association