DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Structure (London, England : 1993) 2009 imex curation Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. DIP original experiment: DIP-132097X Structure (London, England : 1993) 2009 IMEx Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Structure (London, England : 1993) 2009 imex curation Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. DIP original experiment: DIP-132098X Structure (London, England : 1993) 2009 IMEx Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. pkn1_corgl Probable serine/threonine-protein kinase PknB pknB Cgl0041 cg0057 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MTFVIADRYELDAVIGSGGMSEVFAATDTLIGREVAVKMLRIDLAKDPNFRERFRREAQNSGRLSHSSIVAVFDTGEVDKDGTSVPYIVMERVQGRNLREVVTEDGVFTPVEAANILIPVCEALQASHDAGIIHRDVKPANIMITNTGGVKVMDFGIARAVNDSTSAMTQTSAVIGTAQYLSPEQARGKPADARSDIYATGCVMYELVTGKPPFEGESPFAVAYQHVQEDPTPPSDFIADLTPTSAVNVDAVVLTAMAKHPADRYQTASEMAADLGRLSRNAVSHAARAHVETEETPEEPETRFSTRTSTQVAPAAGVAAASTGSGSSSRKRGSRGLTALAIVLSLGVVGVAGAFTYDYFANSSSTATSAIPNVEGLPQQEALTELQAAGFVVNIVEEASADVAEGLVIRANPSVGSEIRQGATVTITVSTGREMINIPDVSGMTLEDAARALEDVGLILNQNVREETSDDVESGLVIDQNPEAGQEVVVGSSVSLTMSSGTESIRVPNLTGMNWSQAEQNLISMGFNPTASYLDSSEPEGEVLSVSSQGTELPKGSSITVEVSNGMLIQAPDLARMSTEQAISALRAAGWTAPDQSLIVGDPIHTAALVDQNKIGFQSPTPATLFRKDAQVQVRLFEFDLAALVQ 0F3B4980ECF73BFB pkn2_corgl Serine/threonine-protein kinases PknA pknA drp72 Cgl0042 cg0059 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDREVAIKVLRPEFSDNQEFLNRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEFVRGESLADLLEREGRLPEDLALDVMEQAAHGLSVIHRMDMVHRDIKPGNMLITANGIVKITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRRPFTGDSSVSVAIAHINQAPPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAVRLGKRPPQPRTSAMMAQAEAPSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAALLAVIIGAVIYAGTTGILFNDTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFTEPETTSHRPTTSEESTSEEPTTEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDAVNGLLDVGGAQ 53C10AD97BB95595 odhi_corgl Oxoglutarate dehydrogenase inhibitor odhI Cgl1441 cg1630 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSDNNGTPEPQVETTSVFRADLLKEMESSTGTAPASTGAENLPAGSALLVVKRGPNAGARFLLDQPTTTAGRHPESDIFLDDVTVSRRHAEFRINEGEFEVVDVGSLNGTYVNREPRNAQVMQTGDEIQIGKFRLVFLAGPAE 1AFFC8459842FCDD mint 1AFFC8459842FCDD cgpkna-odhi-1 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role pT15 pT15 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role Region 1-332 Region 1-332 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation cgpknb-odhi-1 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role pT15 pT15 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 enzyme enzyme unspecified role unspecified role Region 1-313 Region 1-313 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation