DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133015X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133014X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133007X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133010X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133011X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133012X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133009X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133013X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. The WAVE regulatory complex is inhibited. Nature structural & molecular biology 2009 imex curation Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ismail AM., Padrick SB., Chen B., Umetani J., Rosen MK. DIP original experiment: DIP-133008X Nature structural & molecular biology 2009 IMEx The WAVE regulatory complex is inhibited. cyfp1_human Cytoplasmic FMR1-interacting protein 1 Specifically Rac1-associated protein 1 p140sra-1 CYFIP1 KIAA0068 protein protein human Homo sapiens Human MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS DIP protein Q7L576 original sequence version: 55 DIP protein Q7L576-1 original sequence version: 59 DIP protein Q7L576 original sequence version: 59 DIP protein Q7L576 original sequence version: 100 D8F45E13207BEF16 brk1_human Protein BRICK1 C3orf10 BRK1 HSPC300 MDS027 protein protein human Homo sapiens Human MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT DIP protein Q8WUW1 original sequence version: 62 DIP protein Q8WUW1-1 original sequence version: 65 DIP protein Q8WUW1 original sequence version: 106 637B5461A2D96587 abi2_human Abl interactor 2 Abelson interactor 2 Abl-binding protein 3 Arg-binding protein 1 ABI2 ARGBPIA protein protein human Homo sapiens Human MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE DIP protein Q9NYB9 original sequence version: 84 DIP protein Q9NYB9 original sequence version: 88 DIP protein Q9NYB9 original sequence version: 131 822983A69E5EA512 p63000-1 Ras-related C3 botulinum toxin substrate 1 RAC1 Cell migration-inducing gene 5 protein Ras-like protein TC25 TC25 p21-Rac1 MIG5 Rac1A protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL DIP protein P63000-1 original sequence version: 44 DIP protein P63000 original sequence version: 133 DIP protein P63000-1 original sequence version: 128 DIP protein P63000 original sequence version: 90 DIP protein P63000 original sequence version: 91 DIP protein P63000 original sequence version: 92 DIP protein P63000 original sequence version: 80 DIP protein P63000 original sequence version: 106 DIP protein P63000 original sequence version: 95 DIP protein P63000 original sequence version: 112 DIP protein P63000 original sequence version: 128 DIP protein P63000 original sequence version: 137 DIP protein P63000 original sequence version: 157 DIP protein P63000 original sequence version: 116 DIP protein P63000-1 original sequence version: 124 mint ACEDF83A45E5EA67 wasf1_human Wiskott-Aldrich syndrome protein family member 1 WASF1 KIAA0269 SCAR1 WAVE1 Protein WAVE-1 Verprolin homology domain-containing protein 1 protein protein human Homo sapiens Human MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE DIP protein Q92558 original sequence version: 78 DIP protein Q92558 original sequence version: 82 DIP protein Q92558 original sequence version: 124 DIP protein Q92558 original sequence version: 87 44B4527BDB77BC6E q8mlq0_drome HSPC300 SIP1-RA dHSPC300 CG30173 Dmel_CG30173 Dmel\CG30173 SIP1 dHSPC Brk1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYLEACVAQGETLT DIP protein Q8MLQ0 original sequence version: 55 59947DEC8E05437A q9y0s9_drome Abi Abi-1 Ablphilin Dmel\CG9749 abi dAbi Dmel_CG9749 CG9749 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPIKYVRKPIDYSMLDEIGHGINSAQHSQVRQKHRGSSHGSVQSLLPPSVGPPPTTKPPTPPQMSRAGNTGTLGKSVSNTGTLGKSSREYRTPPVVNPPQVPSHYAPNYPIGHPKRMSTASSTMTTTTTGGGAAGNERAAGYSALPMPPSQQIATHVNLPSAGMMQSLPPPPPTTYDDRSSMPPAPPSPLTVSQHEMTEQSHIGMHTLGRNINRNHFSLNFARPGSQSPPLPPPPPPEDEHQDFGRPRTSTGPQLAPIVPEDQNLPGWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVEPCV DIP protein Q9Y0S9 original sequence version: 82 5C60813E4100252E q9w1g7_drome Nap1 Nap1-RA Dmel\CG5330 NAP-1 NAP1 Nap-1 dCAF-4 dNAP-1 dNAP1 dNap1 nap-1 nap1 p56 CG5330 Dmel_CG5330 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDAPAEGHVDPESCNEIEDEKSGSDCQSMPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNGHSYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYYTGDIVDDEDDEDEEEYDENEEDEYDDDDAPPPKGPKSAGIKKQSPNDCPNQ DIP protein Q9W1G7 original sequence version: 73 2600EB48DE11FFF8 nckp1_human Nck-associated protein 1 NCKAP1 HEM2 KIAA0587 NAP1 p125Nap1 Membrane-associated protein HEM-2 protein protein human Homo sapiens Human MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA DIP protein Q9Y2A7 original sequence version: 81 DIP protein Q9Y2A7-1 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 129 12D32BAC7080CB5A q9vkm2_drome Wiskott-Aldrich syndrome protein family member SCAR Scar BEST:SD02991 D-SCAR DWave DmSCAR Dmel\CG4636 Dscar WAVE Wave dWAVE l(2)k03107 l(2)k13811 scar wave Dmel_CG4636 CG4636 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMPAPMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGKKLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSMVNEEAGYGNMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGSPNSVQNANDMVMTQLSNTFHSIGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA DIP protein Q9VKM2 original sequence version: 63 C81578E9FC3F2E95 cyfip_drome Cytoplasmic FMR1-interacting protein Sra-1 Cyfip CG4931 Specifically Rac1-associated protein 1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTEKITLADALSNVEVLDELSLPDEQPCIEAQPCSIIYKANFDTNFEDRNGFVTGIAKYIEEATTHANLNVLLDEGQKHAVMLYTWRCCSRAIPQPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRLCHAEKRKDFVSEAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDLLSDVVNICVHMFETKMYLTPEEKHMLVKVMGFGLFLMDSDACNINKLDQKKKIRLDRIDRIFKNLEVVPLFGDMQIAPFNYIKRSKHFDSSKWPLSSSNAISPQADLMVHLPQIREDHVKYISELARYTNEVTTTVKENPSDAENRITADLALRGLQLLSEWTSVVTELYSWKLLHPTDHHQNKECPVEAEEYERATRYNYTSEEKFALIEVIAMIKGLQVLMARIETVLCEAIRRNIYSELQDFVQLSLREPLRKAVKNKKDLIRSIIMSVRETSADWQKGYEPTDDPVAKGKKDPDGGFRIQVPRLNVGPSSTQLYMVRTMLESLIADKSGGKRTLRKDIDGNCLLQIDTFHKTSFYWSYLLNFSDTLQKCCDLSQLWYREFYLEMTMGRKVNKCLVRHQHNEECKDLITMEKRIQFPIEMSMPWILTDHILQTKEPSMMEFVLYPLDLYNDSAYYALTVFRKQFLYDEVEAEVNLCFDQFVYKLSEQIFAHYKQLAGSIFLDKRFRLECEVLGFNFQSYPRNNRYETLLKQRHVQLLGRSIDLNKLITQRINANMHKSIELAISRFEGNDITGIVELEGLLEANRICHKLLSKYLALDNFDGMVKEANHNVLAPYGRITLHVFVELNYDFLVNYCYNAATNRFIRTKVNLSSSQAIQREKPPQMSHYYLWGSKQLNAAYSTQYGQYTGFVGSPHFHAMCRLLGYQGIAVVMDIILKDIVKPLIQGSLLQFTKTLMIAMPKSCKLPRCEYGSPGVLSYYQAHLTDIVQYPDAKTELFQSFREFGNSIIFCLLIEQALSQEEVCDLLHAALFQNIFPRPFCKENEKPEAKQKRLEAQFANLQIVSNVEKIGTAKQAMIAREGDLLTRERLCCGLSIFEVILNRVKSYLDDPVWCGPPPANGIIHVDECSEFHRLWSALQFVYCIPVRGTEYTIEELFGEGLNWAGCVMIVLLGQQRRFEALDFCYHILRVQRVDGKDEDVKGIQLKRMVDRIRRFQVLNSQIFSILNKYLKGGDGEGSNVEHVRCFPPPQHPSVISSSSHYQDPQKLRQSINN DIP protein Q9VF87 original sequence version: 62 F3E4254BAD41015B abi2-brk1-6 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-178 Region 1-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association abi2-brk1-7 3 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association abi2-brk1-8 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-178 Region 1-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rac1-abi2-1 1 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role prey prey MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 14 unspecified role unspecified role bait bait Region 1-178 Region 1-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association abi2-brk1-9 5 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-178 Region 1-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rac1-cyfip1-1 2 18 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association cyfip1-nckap1-2 7 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction abi-hspc300-1 6 15 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association abi2-brk1-10 9 18 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 11 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 12 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association