DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216535X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216534X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216536X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216533X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216532X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Okuda S., Tokuda H. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Okuda S., Tokuda H. DIP original experiment: DIP-216537X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Model of mouth-to-mouth transfer of bacterial lipoproteins through inner membrane LolC, periplasmic LolA, and outer membrane LolB. lola_ecoli Outer-membrane lipoprotein carrier protein yzzV P20 lolA lplA b0891 JW0874 protein protein ecoli Escherichia coli (strain K12) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK DIP protein P61316 original sequence version: 77 F2884D82D8DFEF1D pal_ecoli Peptidoglycan-associated lipoprotein pal excC b0741 JW0731 Tol-Pal system lipoprotein Pal protein protein ecoli Escherichia coli (strain K12) MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY DIP protein P0A912 original sequence version: 52 449F9959C0274430 lolb_ecoli Outer-membrane lipoprotein LolB ychC lolB hemM b1209 JW1200 protein protein ecoli Escherichia coli (strain K12) MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK DIP protein P61320 original sequence version: 77 C517F6E7353B8551 lolc_ecoli Lipoprotein-releasing system transmembrane protein LolC lolC ycfU b1116 JW5161 protein protein ecoli Escherichia coli (strain K12) MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE DIP protein P0ADC3 original sequence version: 46 lola-lolb-1 5 9 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C22A mutation'. Wed May 02 14:53:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys22ala' Tue Jun 30 15:34:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys22Ala' ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K155pBPA K155pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q173pBPA Q173pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lola-lolc-1 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D55pBPA D55pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T176pBPA T176pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lolb-pal-1 2 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C22A mutation'. Wed May 02 20:26:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys22ala' Tue Jun 30 17:51:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys22Ala' V46pBPA V46pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W52pBPA W52pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y39pBPA Y39pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D86pBPA D86pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R91pBPA R91pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R115pBPA R115pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain N144pBPA N144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y152pBPA Y152pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q174pBPA Q174pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lola-lolb-2 3 9 unspecified role unspecified role unspecified role unspecified role 22-207 binding region 22-207 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain P61320:p.Cys22Ala C22A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain C A This feature has been corrected as a result of our quality control procedures. The original label was 'C22A mutation'. Wed May 02 20:09:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys22ala' Tue Jun 30 17:02:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys22Ala' I40pBPA I40pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K45pBPA K45pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R49pBPA R49pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T65pBPA T65pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction lola-pal-1 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role V20pBPA V20pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain V24pBPA V24pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R43pBPA R43pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F72pBPA F72pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F90pBPA F90pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain I93pBPA I93pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S99pBPA S99pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F127pBPA F127pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E144pBPA E144pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T176pBPA T176pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lola-lolc-2 6 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Q33pBPA Q33pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L59pBPA L59pBPA modphe modified L-phenylalanine residue ModPhe substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction