DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lalioti V., Muruais G., Dinarina A., van Damme J., Vandekerckhove J., Sandoval IV. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lalioti V., Muruais G., Dinarina A., van Damme J., Vandekerckhove J., Sandoval IV. DIP original experiment: DIP-133846X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lalioti V., Muruais G., Dinarina A., van Damme J., Vandekerckhove J., Sandoval IV. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lalioti V., Muruais G., Dinarina A., van Damme J., Vandekerckhove J., Sandoval IV. DIP original experiment: DIP-133845X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The atypical kinase Cdk5 is activated by insulin, regulates the association between GLUT4 and E-Syt1, and modulates glucose transport in 3T3-L1 adipocytes. esyt1_mouse Extended synaptotagmin-1 Mbc2 Membrane-bound C2 domain-containing protein Esyt1 Fam62a protein protein mouse Mus musculus Mouse MEHSPEEGASPEPSGQPPATDSTRDGGSGVPPAGPGAASEALAVLTSFGRRLLVLVPVYLAGAAGLSVGFVLFGLALYLGWRRVRDGKERSLRAARQLLDDEERITAETLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGANPHLQTFTFTRVELGEKPLRIIGVKVHPSQRKDQILLDLNVSYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRVILEPLTGDLPIVGAVSMFFIKRPTLDINWTGMTNLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRVGTQTFCSRVIDEELNPHWGETYEVIVHEVPGQEIEVEVFDKDPDKDDFLGRMKLDVGKVLQAGVLDNWYPLQGGQGQVHLRLEWLSLLPDAEKLDQVLQWNRGITSRPEPPSAAILVVYLDRAQDLPLKKGNKEPNPMVQLSVQDVTRESKATYSTNSPVWEEAFRFFLQDPRSQELDVQVKDDSRALTLGALTLPLARLLTASELTLDQWFQLSSSGPNSRLYMKLVMRILYLDYSEIRFPTVPGAQDWDRESLETGSSVDAPPRPYHTTPNSHFGTENVLRIHVLEAQDLIAKDRFLGGLVKGKSDPYVKLKVAGKSFRTHVVREDLNPRWNEVFEVIVTSIPGQELEIEVFDKDLDKDDFLGRYKVSLTTVLNSGFLDEWLTLEDVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSSELAAALLSVFLERAEDLPLRKGTKPPSPYATITVGETSHKTKTVSQSSAPVWEESASFLIRKPHAESLELQVRGEGTGTLGSVSLPLSELLQEDQLCLDHWFALSGQGQVLMRAQLGILVSQHSGVEAHSHSYSHSHSSSSLNDEPEALGGPTHPASPVLEVRHRLTHGDSPSEAPVGPLGQVKLTVWYHSDEQKLISIIHSCRALRQNGRDLPDPYVSVLLLPDKNRSTKRKTPQKKRTLNPEFNERFEWDLPLDGTLRRKLDVSVKSNSSFMSRERELLGKVQLDLAEIDLSQGAAQWYDLMDDRDKGGS 71A397EC52DE6DA9 May play a role as calcium-regulated intrinsic membrane protein mint 71A397EC52DE6DA9 glut4_mouse Solute carrier family 2, facilitated glucose transporter member 4 Slc2a4 Glut4 Glucose transporter type 4, insulin-responsive GT2 protein protein mouse Mus musculus Mouse MPSGFQQIGSDDGEPPRQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATWLGRQGPGGPDSIPQGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAELKDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFESAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQISAAFRRTPSLLEQEVKPSTELEYLGPDEND DIP protein P14142 original sequence version: 111 mint Insulin-regulated facilitative glucose transporter Defects in Slc2a4 may be the cause of certain post-receptor defects in non-insulin-dependent diabetes mellitus (NIDDM) A174212455EE0390 cdk5_mouse Cyclin-dependent-like kinase 5 Cdk5 Cdkn5 Crk6 CR6 protein kinase Cell division protein kinase 5 Serine/threonine-protein kinase PSSALRE Tau protein kinase II catalytic subunit protein protein mouse Mus musculus Mouse MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein P49615 original sequence version: 65 DIP protein P49615 original sequence version: 103 4CB11CED9017D535 e_syt1-cdk5-1 2 3 unspecified role unspecified role bait bait mouse Mus musculus Mouse 4 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association slc2a4-e_syt1-1 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 4 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association