DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249867X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249865X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249864X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249866X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249869X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. Nature 2009 imex curation Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Schneider MC., Prosser BE., Caesar JJ., Kugelberg E., Li S., Zhang Q., Quoraishi S., Lovett JE., Deane JE., Sim RB., Roversi P., Johnson S., Tang CM., Lea SM. DIP original experiment: DIP-249868X Nature 2009 IMEx Neisseria meningitidis recruits factor H using protein mimicry of host carbohydrates. q9jxv4_neimb Lipoprot_C domain-containing protein NMB1870 protein protein strain mc58 Neisseria meningitidis serogroup B MPSEPPFGRHLIFASLTCLIDAVCKKRYHNQNVYILSILRMTRSKPVNRTAFCCLSLTTALILTACSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ 8CA166BCAC1B005C cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR DIP protein P08603 original sequence version: 161 DIP protein P08603-1 original sequence version: 149 3C26D62A2BF9BFEE cfh-fhbp-1 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 321-443 Region 321-443 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cfh-fhbp-2 5 7 unspecified role unspecified role prey prey ecolx Escherichia coli 8 unspecified role unspecified role bait bait Region 321-506 Region 321-506 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cfh-fhbp-3 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 321-443 Region 321-443 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fhbp-cfh-1 1 7 unspecified role unspecified role bait bait ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction fhbp-cfh-2 4 7 unspecified role unspecified role bait bait Q9JXV4:p.[Glu283Ala;Glu304Ala] E283A/E304A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E283A/E304A'. Wed May 02 19:03:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu283ala,glu304ala' Tue Jun 30 17:01:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu283Ala;Glu304Ala]' ecolx Escherichia coli 8 unspecified role unspecified role prey prey Region 321-443 Region 321-443 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P08603:p.[His337Ala;Arg341Ala] R341A/H337A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'R341A/H337A'. Wed May 02 19:40:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his337ala,arg341ala' Tue Jun 30 18:46:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His337Ala;Arg341Ala]' ecolx Escherichia coli direct interaction direct interaction fhbp-cfh-3 6 7 unspecified role unspecified role bait bait ecolx Escherichia coli 8 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction