DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Active-site inhibitors of mTOR target rapamycin-resistant outputs of mTORC1 and mTORC2. Active-site inhibitors of mTOR target rapamycin-resistant outputs of mTORC1 and mTORC2. PLoS biology 2009 imex curation Feldman ME., Apsel B., Uotila A., Loewith R., Knight ZA., Ruggero D., Shokat KM. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Feldman ME., Apsel B., Uotila A., Loewith R., Knight ZA., Ruggero D., Shokat KM. DIP original experiment: DIP-132560X PLoS biology 2009 IMEx Active-site inhibitors of mTOR target rapamycin-resistant outputs of mTORC1 and mTORC2. if4e_mouse Eukaryotic translation initiation factor 4E Eif4e eIF-4F 25 kDa subunit protein protein mouse Mus musculus Mouse MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV DIP protein P63073 original sequence version: 68 DIP protein P63073 original sequence version: 67 DIP protein P63073 original sequence version: 87 DIP protein P63073 original sequence version: 119 DIP protein P63073 original sequence version: 85 FC61D0FB337BCD8F 4ebp1_mouse Eukaryotic translation initiation factor 4E-binding protein 1 Eif4ebp1 Phosphorylated heat- and acid-stable protein regulated by insulin 1 protein protein mouse Mus musculus Mouse MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI DIP protein Q60876 original sequence version: 79 3458D5687468A7EA eif4e-eif4ebp1-14 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 2 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association