DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. DIP original experiment: DIP-133789X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. Only protein-protein interactions tobac Nicotiana tabacum (Common tobacco) Common tobacco molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. DIP original experiment: DIP-133790X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. DIP original experiment: DIP-133787X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Rubisco in complex with Rubisco large subunit methyltransferase. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Raunser S., Magnani R., Huang Z., Houtz RL., Trievel RC., Penczek PA., Walz T. DIP original experiment: DIP-133788X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Rubisco in complex with Rubisco large subunit methyltransferase. rbl_spiol Ribulose bisphosphate carboxylase large chain rbcL protein protein spiol Spinacia oleracea (Spinach) Spinach MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV DIP protein P00875 original sequence version: 108 mint RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site 484FFFFD36BB1238 rbcmt_pea Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic RBCMT [Fructose-bisphosphate aldolase]-lysine N-methyltransferase [Ribulose-bisphosphate carboxylase]-lysine N-methyltransferase protein protein pea Pisum sativum (Garden pea) Garden pea MATIFSGGSVSPFLFHTNKGTSFTPKAPILHLKRSFSAKSVASVGTEPSLSPAVQTFWKWLQEEGVITAKTPVKASVVTEGLGLVALKDISRNDVILQVPKRLWINPDAVAASEIGRVCSELKPWLSVILFLIRERSREDSVWKHYFGILPQETDSTIYWSEEELQELQGSQLLKTTVSVKEYVKNECLKLEQEIILPNKRLFPDPVTLDDFFWAFGILRSRAFSRLRNENLVVVPMADLINHSAGVTTEDHAYEVKGAAGLFSWDYLFSLKSPLSVKAGEQVYIQYDLNKSNAELALDYGFIEPNENRHAYTLTLEISESDPFFDDKLDVAESNGFAQTAYFDIFYNRTLPPGLLPYLRLVALGGTDAFLLESLFRDTIWGHLELSVSRDNEELLCKAVREACKSALAGYHTTIEQDRELKEGNLDSRLAIAVGIREGEKMVLQQIDGIFEQKELELDQLEYYQERRLKDLGLCGENGDILGDLGKFF DIP protein Q43088 original sequence version: 68 rbs_tobac Ribulose bisphosphate carboxylase small subunit, chloroplastic RBCS TSSU3-8 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MASSVLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEGY DIP protein P69249 original sequence version: 38 26CF3F48EF0860AD rbs1_spiol Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 RBCS1 RBCS protein protein spiol Spinacia oleracea (Spinach) Spinach MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEFEVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY DIP protein P00870 original sequence version: 83 DC727DD6EF1EF59B rbl_tobac Ribulose bisphosphate carboxylase large chain rbcL rbcA protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDFVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAQEGNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK DIP protein P00876 original sequence version: 98 RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site mint 232D54E42263198F rbcl-rbcmt-1 1 5 unspecified role unspecified role unspecified role unspecified role spiol Spinacia oleracea (Spinach) Spinach 6 unspecified role unspecified role unspecified role unspecified role Region 38-485 Region 38-485 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role spiol Spinacia oleracea (Spinach) Spinach physical association physical association rbcl-rbcmt-2 3 5 unspecified role unspecified role unspecified role unspecified role spiol Spinacia oleracea (Spinach) Spinach 6 unspecified role unspecified role unspecified role unspecified role Region 38-485 Region 38-485 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role spiol Spinacia oleracea (Spinach) Spinach physical association physical association rbcl-rbcmt-3 4 9 enzyme target enzyme target substrate substrate unspecified role unspecified role tobac Nicotiana tabacum (Common tobacco) Common tobacco 6 enzyme enzyme unspecified role unspecified role Region 38-485 Region 38-485 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli methylation methylation reaction methylation rbcl-rbcs-2 2 9 unspecified role unspecified role unspecified role unspecified role tobac Nicotiana tabacum (Common tobacco) Common tobacco 7 unspecified role unspecified role unspecified role unspecified role tobac Nicotiana tabacum (Common tobacco) Common tobacco direct interaction direct interaction