DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Integrity of the AID serine-38 phosphorylation site is critical for class switch recombination and somatic hypermutation in mice. Integrity of the AID serine-38 phosphorylation site is critical for class switch recombination and somatic hypermutation in mice. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Cheng HL., Vuong BQ., Basu U., Franklin A., Schwer B., Astarita J., Phan RT., Datta A., Manis J., Alt FW., Chaudhuri J. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheng HL., Vuong BQ., Basu U., Franklin A., Schwer B., Astarita J., Phan RT., Datta A., Manis J., Alt FW., Chaudhuri J. DIP original experiment: DIP-133759X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Integrity of the AID serine-38 phosphorylation site is critical for class switch recombination and somatic hypermutation in mice. aicda_mouse Single-stranded DNA cytosine deaminase Aicda Aid Cytidine aminohydrolase Activation-induced cytidine deaminase protein protein mouse Mus musculus Mouse MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF DIP protein Q9WVE0 original sequence version: 66 18A3BA10CA54BEB2 rfa2_mouse Replication protein A 32 kDa subunit Rpa2 Rpa34 Replication factor A protein 2 Replication protein A 34 kDa subunit protein protein mouse Mus musculus Mouse MWNSGFESFTSSTYGGRGGYTQSPGGFGSPTPSQAEKKSRVRAQHIVPCTISQLLSATLTDEVFRIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAPPMDVRQWVDTDDASGENAVVPPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHMMLSKPNSQASAGRPSMSNPGMSESFNFSGNNFMPANRLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVPSIKQAVDFLCNEGHIYSTVDDDHFKSTDAE DIP protein Q62193 original sequence version: 75 aicda-rpa2-1 1 3 unspecified role unspecified role prey prey mouse Mus musculus Mouse 2 unspecified role unspecified role bait bait Q9WVE0:p.Ser38Ala S38A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S38A'. Wed May 02 19:12:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser38ala' Tue Jun 30 19:44:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser38Ala' mouse Mus musculus Mouse physical association physical association