DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. Nature structural & molecular biology 2009 imex curation Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. DIP original experiment: DIP-132960X Nature structural & molecular biology 2009 IMEx MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. Nature structural & molecular biology 2009 imex curation Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. DIP original experiment: DIP-132957X Nature structural & molecular biology 2009 IMEx MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. Nature structural & molecular biology 2009 imex curation Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. DIP original experiment: DIP-132959X Nature structural & molecular biology 2009 IMEx MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. Nature structural & molecular biology 2009 imex curation Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. DIP original experiment: DIP-132956X Nature structural & molecular biology 2009 IMEx MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. Nature structural & molecular biology 2009 imex curation Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Banci L., Bertini I., Cefaro C., Ciofi-Baffoni S., Gallo A., Martinelli M., Sideris DP., Katrakili N., Tokatlidis K. DIP original experiment: DIP-132958X Nature structural & molecular biology 2009 IMEx MIA40 is an oxidoreductase that catalyzes oxidative protein folding in mitochondria. mia40_yeast Mitochondrial intermembrane space import and assembly protein 40 YKL195W MIA40 TIM40 Mitochondrial import inner membrane translocase TIM40 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNLVVRNACRNRPSIQVARGLCRHQTRRLMASSPQFGRNSNQEKTAGFIMGILSMAGALYFIAPNRKPLFASRKVESDKTAEEELSSGGEQSPENEDDNNSKSDENGDDNDSKNDETEAGPQLGGDKIGASKVAEDGELVVLAEEDNKSSEDKDTDESKVSTKDDEQSNEDNATANNQKDENISSENSEENTSDKTLDNNAGSSEKKDPEHSDDEKSQQGQSDDKTTTEDNNGEEESSKKTVSDSENSAKQSESSDEEKEELRKQEEKQMGPTEEEVQHEGAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLKETSDDEEPQDKVKVNTIESAPNVSSAKENAAKKAEQSDVKKEPLNEESKP 5904E8D0213D6EFA 5904E8D0213D6EFA tim10_yeast Mitochondrial import inner membrane translocase subunit TIM10 MRS11 YHR005BC YHR005C-A TIM10 Mitochondrial intermembrane protein MRS11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF 70DD4764B944FF17 70DD4764B944FF17 cox17_human Cytochrome c oxidase copper chaperone COX17 protein protein human Homo sapiens Human MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI DIP protein Q14061 original sequence version: 63 DIP protein Q14061 original sequence version: 82 E97090F939E78276 q8n4q1-1 Mitochondrial intermembrane space import and assembly protein 40 CHCHD4 MIA40 Coiled-coil-helix-coiled-coil-helix domain-containing protein 4 protein protein human Homo sapiens Human MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS DIP protein Q8N4Q1-1 original sequence version: 58 chchd4-cox17-1 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction ymia40-ytim10-1 3 6 unspecified role unspecified role bait bait P36046:p.[Cys296Ser;Cys298Ser] C296S/C298S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C296S/C298S'. Wed May 02 18:43:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys296ser,cys298ser' Tue Jun 30 19:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys296Ser;Cys298Ser]' P36046:p.Cys298Ser C298S mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C298S'. Wed May 02 16:46:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys298ser' Tue Jun 30 16:31:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys298Ser' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction chchd4-cox17-2 2 8 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction chchd4-ytim10-1 5 7 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction ymia40-cox17-1 1 8 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait P36046:p.[Cys296Ser;Cys298Ser] C296S/C298S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C296S/C298S'. Wed May 02 15:39:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys296ser,cys298ser' Tue Jun 30 19:16:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys296Ser;Cys298Ser]' P36046:p.Cys298Ser C298S mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C298S'. Wed May 02 19:34:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys298ser' Tue Jun 30 16:28:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys298Ser' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction