DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132157X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132155X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132158X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132152X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132153X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132156X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. Structure (London, England : 1993) 2009 imex curation McElroy CA., Dohm JA., Walsh ST. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined McElroy CA., Dohm JA., Walsh ST. DIP original experiment: DIP-132154X Structure (London, England : 1993) 2009 IMEx Structural and biophysical studies of the human IL-7/IL-7Ralpha complex. il7_human Interleukin-7 IL7 protein protein human Homo sapiens Human MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH DIP protein P13232 original sequence version: 103 8FC5243F9169617F il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ EF50BF2615EEF50C il7-il7r-4 4 9 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction il7r-il7-1 1 9 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction il7r-il7-2 2 9 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction il7-il7r-5 5 9 unspecified role unspecified role unspecified role unspecified role Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction il7r-il7-3 3 9 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction il7r-il7-4 6 9 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction il7r-il7-5 7 9 unspecified role unspecified role bait bait Region 21-239 Region 21-239 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction