DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The nuclear membrane organization of leukotriene synthesis. The nuclear membrane organization of leukotriene synthesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133583X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. The nuclear membrane organization of leukotriene synthesis. The nuclear membrane organization of leukotriene synthesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133584X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. The nuclear membrane organization of leukotriene synthesis. The nuclear membrane organization of leukotriene synthesis. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mandal AK., Jones PB., Bair AM., Christmas P., Miller D., Yamin TT., Wisniewski D., Menke J., Evans JF., Hyman BT., Bacskai B., Chen M., Lee DM., Nikolic B., Soberman RJ. DIP original experiment: DIP-133582X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The nuclear membrane organization of leukotriene synthesis. al5ap_rat Arachidonate 5-lipoxygenase-activating protein Alox5ap Flap FLAP MK-886-binding protein protein protein rat Rattus norvegicus (Rat) Rat MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP DIP protein P20291 original sequence version: 75 lox5_rat Polyunsaturated fatty acid 5-lipoxygenase Alox5 Arachidonate 5-lipoxygenase protein protein rat Rattus norvegicus (Rat) Rat MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGGRDSYDVTVDEELGEIYLVKIEKRKYRLHDDWYLKYITLKTPHDYIEFPCYRWITGEGEIVLRDGCAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNGCNPVLIKRCTELPKKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDPCTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGEKNPIFLPTDSKYDWLLAKIWVRSSDFHIHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLNCEYGLFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDNTEDIPYYFYRDDGLLVWEAIQSFTTEVVSIYYEDDQVVEEDQELQDFVKDVYVYGMRGRKASGFPKSIKSREKLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPYYYLSPDRIPNSVAI DIP protein P12527 original sequence version: 100 alox5-alox5ap-1 3 4 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 5 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association alox5ap-1 1 4 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat physical association physical association alox5-alox5ap-2 2 4 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat 5 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat physical association physical association