DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structural basis of integrin-linked kinase-PINCH interactions. The structural basis of integrin-linked kinase-PINCH interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133594X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. The structural basis of integrin-linked kinase-PINCH interactions. The structural basis of integrin-linked kinase-PINCH interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133593X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. The structural basis of integrin-linked kinase-PINCH interactions. The structural basis of integrin-linked kinase-PINCH interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chiswell BP., Zhang R., Murphy JW., Boggon TJ., Calderwood DA. DIP original experiment: DIP-133595X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The structural basis of integrin-linked kinase-PINCH interactions. ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 lims1_human LIM and senescent cell antigen-like-containing domain protein 1 LIMS1 Particularly interesting new Cys-His protein 1 Renal carcinoma antigen NY-REN-48 PINCH PINCH1 protein protein human Homo sapiens Human MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK DIP protein P48059 original sequence version: 110 E665FEB11D849CAE ilk-lims1-6 2 5 unspecified role unspecified role unspecified role unspecified role Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 1-174 Region 1-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ilk-lims1-7 3 5 unspecified role unspecified role unspecified role unspecified role Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 1-174 Region 1-174 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lims1-ilk-1 1 5 unspecified role unspecified role bait bait Region 6-68 Region 6-68 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P48059:p.Phe42Ala F42A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F42A'. Wed May 02 15:08:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe42ala' Tue Jun 30 18:14:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe42Ala' P48059:p.Asp62Ala D62A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D62A'. Wed May 02 16:50:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp62ala' Tue Jun 30 17:19:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp62Ala' P48059:p.Leu66Asp L66D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L66D'. Wed May 02 19:32:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu66asp' Tue Jun 30 19:35:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu66Asp' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey Region 1-192 Region 1-192 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q13418:p.His99Asp H99D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H D This feature has been corrected as a result of our quality control procedures. The original label was 'H99D'. Wed May 02 15:42:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his99asp' Tue Jun 30 19:05:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His99Asp' ecolx Escherichia coli direct interaction direct interaction