DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Hwang CS., Varshavsky A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hwang CS., Varshavsky A. DIP original experiment: DIP-133526X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Hwang CS., Varshavsky A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hwang CS., Varshavsky A. DIP original experiment: DIP-133525X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Hwang CS., Varshavsky A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hwang CS., Varshavsky A. DIP original experiment: DIP-133524X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Hwang CS., Varshavsky A. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hwang CS., Varshavsky A. DIP original experiment: DIP-133523X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Hwang CS., Varshavsky A. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hwang CS., Varshavsky A. DIP original experiment: DIP-133527X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Regulation of peptide import through phosphorylation of Ubr1, the ubiquitin ligase of the N-end rule pathway. mck1_yeast Protein kinase MCK1 YPK1 YNL307C N0392 MCK1 Meiosis and centromere regulatory kinase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTEEQNGVPLQRGSEFIADDVTSNKSNNTRRMLVKEYRKIGRGAFGTVVQAYLTQDKKNWLGPFAIKKVPAHTEYKSRELQILRIADHPNIVKLQYFFTHLSPQDNKVYQHLAMECLPETLQIEINRYVTNKLEMPLKHIRLYTYQIARGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLGPPDKRFIFFSNPAYDGPLFSKPLFSGSSQQRFEKYFGHSGPDGIDLLMKILVYEPQQRLSPRRILAHQFFNELRNDDTFLPRGFTEPIKLPNLFDFNDFELQILGEFADKIKPTKVAE BCF0C776B6E3841B BCF0C776B6E3841B ubr1_yeast E3 ubiquitin-protein ligase UBR1 UBR1 PTR1 N-recognin-1 N-end-recognizing protein RING-type E3 ubiquitin transferase UBR1 G7168 YGR184C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVADDDLGSLQGHIRRTLRSIHNLPYFRYTRGPTERADMSRALKEFIYRYLYFVISNSGENLPTLFNAHPKQKLSNPELTVFPDSLEDAVDIDKITSQQTIPFYKIDESRIGDVHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHVCTDICTEFTSGICDCGDEEAWNSPLHCKAEEQENDISEDPATNADIKEEDVWNDSVNIALVELVLAEVFDYFIDVFNQNIEPLPTIQKDITIKLREMTQQGKMYERAQFLNDLKYENDYMFDGTTTAKTSPSNSPEASPSLAKIDPENYTVIIYNDEYHNYSQATTALRQGVPDNVHIDLLTSRIDGEGRAMLKCSQDLSSVLGGFFAVQTNGLSATLTSWSEYLHQETCKYIILWITHCLNIPNSSFQTTFRNMMGKTLCSEYLNATECRDMTPVVEKYFSNKFDKNDPYRYIDLSILADGNQIPLGHHKILPESSTHSLSPLINDVETPTSRTYSNTRLQHILYFDNRYWKRLRKDIQNVIIPTLASSNLYKPIFCQQVVEIFNHITRSVAYMDREPQLTAIRECVVQLFTCPTNAKNIFENQSFLDIVWSIIDIFKEFCKVEGGVLIWQRVQKSNLTKSYSISFKQGLYTVETLLSKVHDPNIPLRPKEIISLLTLCKLFNGAWKIKRKEGEHVLHEDQNFISYLEYTTSIYSIIQTAEKVSEKSKDSIDSKLFLNAIRIISSFLGNRSLTYKLIYDSHEVIKFSVSHERVAFMNPLQTMLSFLIEKVSLKDAYEALEDCSDFLKISDFSLRSVVLCSQIDVGFWVRNGMSVLHQASYYKNNPELGSYSRDIHLNQLAILWERDDIPRIIYNILDRWELLDWFTGEVDYQHTVYEDKISFIIQQFIAFIYQILTERQYFKTFSSLKDRRMDQIKNSIIYNLYMKPLSYSKLLRSVPDYLTEDTTEFDEALEEVSVFVEPKGLADNGVFKLKASLYAKVDPLKLLNLENEFESSATIIKSHLAKDKDEIAKVVLIPQVSIKQLDKDALNLGAFTRNTVFAKVVYKLLQVCLDMEDSTFLNELLHLVHGIFRDDELINGKDSIPEAYLSKPICNLLLSIANAKSDVFSESIVRKADYLLEKMIMKKPNELFESLIASFGNQYVNDYKDKKLRQGVNLQETEKERKRRLAKKHQARLLAKFNNQQTKFMKEHESEFDEQDNDVDMVGEKVYESEDFTCALCQDSSSTDFFVIPAYHDHSPIFRPGNIFNPNEFMPMWDGFYNDDEKQAYIDDDVLEALKENGSCGSRKVFVSCNHHIHHNCFKRYVQKKRFSSNAFICPLCQTFSNCTLPLCQTSKANTGLSLDMFLESELSLDTLSRLFKPFTEENYRTINSIFSLMISQCQGFDKAVRKRANFSHKDVSLILSVHWANTISMLEIASRLEKPYSISFFRSREQKYKTLKNILVCIMLFTFVIGKPSMEFEPYPQQPDTVWNQNQLFQYIVRSALFSPVSLRQTVTEALTTFSRQFLRDFLQGLSDAEQVTKLYAKASKIGDVLKVSEQMLFALRTISDVRMEGLDSESIIYDLAYTFLLKSLLPTIRRCLVFIKVLHELVKDSENETLVINGHEVEEELEFEDTAEFVNKALKMITEKESLVDLLTTQESIVSHPYLENIPYEYCGIIKLIDLSKYLNTYVTQSKEIKLREERSQHMKNADNRLDFKICLTCGVKVHLRADRHEMTKHLNKNCFKPFGAFLMPNSSEVCLHLTQPPSNIFISAPYLNSHGEVGRNAMRRGDLTTLNLKRYEHLNRLWINNEIPGYISRVMGDEFRVTILSNGFLFAFNREPRPRRIPPTDEDDEDMEEGEDGFFTEGNDEMDVDDETGQAANLFGVGAEGIAGGGVRDFFQFFENFRNTLQPQGNGDDDAPQNPPPILQFLGPQFDGATIIRNTNPRNLDEDDSDDNDDSDEREIW 33E4CD3A031AF523 33E4CD3A031AF523 kc11_yeast Casein kinase I homolog 1 YCK1 CKI2 YHR135C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMPIASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPARSSMTATTAANSNSNSSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDLNINKKPNLHGYGHPNPPNEKSRKHRNKQLQMQQLQMQQLQQQQQQQQYAQKTEADMRNSQYKPKLDPTSYEAYQHQTQQKYLQEQQKRQQQQKLQEQQLQEQQLQQQQQQQQQLRATGQPPSQPQAQTQSQQFGARYQPQQQPSAALRTPEQHPNDDNSSLAASHKGFFQKLGCC 77344717818C2D17 77344717818C2D17 yck1-ubr1-1 2 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mck1-ubr1-1 4 7 enzyme target enzyme target substrate substrate unspecified role unspecified role P19812:p.Tyr277Phe Y277F mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F This feature has been corrected as a result of our quality control procedures. The original label was 'Y277F'. Wed May 02 19:12:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277phe' Tue Jun 30 18:33:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Phe' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 enzyme enzyme unspecified role unspecified role P21965:p.Asp164Ala D164A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D164A'. Wed May 02 17:41:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp164ala' Tue Jun 30 16:49:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp164Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation ubr1-yck1-1 5 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mck1-ubr1-2 1 6 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ubr1-mck1-1 3 6 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association