DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. DIP original experiment: DIP-133502X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. DIP original experiment: DIP-133504X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. DIP original experiment: DIP-133503X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Schlieker CD., Van der Veen AG., Damon JR., Spooner E., Ploegh HL. DIP original experiment: DIP-133505X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway. urm1_human Ubiquitin-related modifier 1 URM1 C9orf74 protein protein human Homo sapiens Human MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG DIP protein Q9BTM9 original sequence version: 65 DIP protein Q9BTM9-1 original sequence version: 90 8DE9B11957866155 hs71b_human Heat shock 70 kDa protein 1B HSPA1B HSP72 Heat shock 70 kDa protein 2 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD 78F513118C96DE66 78F513118C96DE66 ctu1_human Cytoplasmic tRNA 2-thiolation protein 1 CTU1 ATPBD3 NCS6 ATP-binding domain-containing protein 3 Cancer-associated gene protein Cytoplasmic tRNA adenylyltransferase 1 protein protein human Homo sapiens Human MPAPPCASCHAARAALRRPLSGQALCGACFCAAFEAEVLHTVLAGRLLPPGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGSPGEGGALPRCRPLQFASQKEVVLYAHFRRLDYFSEECVYAPEAFRGHARDLLKRLEAARPSAVLDLVHSAERLALAPAARPPRPGACSRCGALASRALCQACALLDGLNRGRPRLAIGKGRRGLDEEATPGTPGDPARPPASKAVPTF DIP protein Q7Z7A3 original sequence version: 52 DIP protein Q7Z7A3 original sequence version: 75 ctu2_human Cytoplasmic tRNA 2-thiolation protein 2 CTU2 C16orf84 NCS2 Cytosolic thiouridylase subunit 2 protein protein human Homo sapiens Human MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFRAMLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS DIP protein Q2VPK5 original sequence version: 44 DIP protein Q2VPK5 original sequence version: 67 urm1-ctu1-1 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association ctu1-ctu2-2 4 6 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 5 unspecified role unspecified role prey prey human Homo sapiens Human association association ctu1-urm1-1 3 7 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 5 unspecified role unspecified role unspecified role unspecified role in vitro In vitro direct interaction direct interaction urm1-ctu1-2 2 7 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 5 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association