DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structure (London, England : 1993) 2008 imex curation Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113485X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structure (London, England : 1993) 2008 imex curation Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113483X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structure (London, England : 1993) 2008 imex curation Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati weight by comassie molecular weight estimation by coomasie staining weight by comassie Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113484X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. Structure (London, England : 1993) 2008 imex curation Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kursula I., Kursula P., Ganter M., Panjikar S., Matuschewski K., Schüler H. DIP original experiment: DIP-113486X Structure (London, England : 1993) 2008 IMEx Structural basis for parasite-specific functions of the divergent profilin of Plasmodium falciparum. octaproline Octaproline peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPPPPPPP prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY DIP protein P07737 original sequence version: 73 DIP protein P07737 original sequence version: 160 DIP protein P07737 original sequence version: 97 DIP protein P07737 original sequence version: 98 DIP protein P07737 original sequence version: 168 DIP protein P07737 original sequence version: 140 F725119E55A289EB actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 prof_plaf7 Profilin Pfn PFI1565w protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAEEYSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLFYKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFINIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGNSKIAALTFAKELAESSQ DIP protein Q8I2J4 original sequence version: 24 actb-pfn1-1 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction octaproline-pfn-1 2 5 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction actb-4 3 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction actb-pfn-1 1 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction