DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113251X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113247X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113249X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113250X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113246X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure and plasticity of Endophilin and Sorting Nexin 9. Structure (London, England : 1993) 2008 imex curation Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Wang Q., Kaan HY., Hooda RN., Goh SL., Sondermann H. DIP original experiment: DIP-113248X Structure (London, England : 1993) 2008 IMEx Structure and plasticity of Endophilin and Sorting Nexin 9. snx9_human Sorting nexin-9 SNX9 SH3PX1 SH3PXD3A SH3 and PX domain-containing protein 1 SH3 and PX domain-containing protein 3A protein protein human Homo sapiens Human MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM DIP protein Q9Y5X1 original sequence version: 123 DIP protein Q9Y5X1 original sequence version: 70 963892AC1A5A9227 sh3g2_mouse Endophilin-A1 Sh3gl2 Sh3d2a Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A Een1 SH3p4 protein protein mouse Mus musculus Mouse MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH DIP protein Q62420 original sequence version: 77 8C2B6F0FB245DCD3 snx9-1 5 7 unspecified role unspecified role unspecified role unspecified role Region 230-595 Region 230-595 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snx9-2 3 7 unspecified role unspecified role unspecified role unspecified role Region 230-595 Region 230-595 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sh3gl2-1 4 8 unspecified role unspecified role unspecified role unspecified role Region 1-256 Region 1-256 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snx9-3 2 7 unspecified role unspecified role unspecified role unspecified role Region 230-595 Region 230-595 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snx9-4 6 7 unspecified role unspecified role unspecified role unspecified role Region 230-595 Region 230-595 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction sh3gl2-2 1 8 unspecified role unspecified role unspecified role unspecified role Region 1-256 Region 1-256 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction