DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113245X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113239X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113244X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113240X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113243X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113241X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113242X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. Structure (London, England : 1993) 2008 imex curation Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suzuki H., Kawasaki M., Inuzuka T., Okumura M., Kakiuchi T., Shibata H., Wakatsuki S., Maki M. DIP original experiment: DIP-113238X Structure (London, England : 1993) 2008 IMEx Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism. pdcd6_human Programmed cell death protein 6 PDCD6 ALG2 Apoptosis-linked gene 2 protein homolog protein protein human Homo sapiens Human MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV DIP protein O75340 original sequence version: 73 DIP protein O75340 original sequence version: 154 D0B5944CF3C696AD cep55_human Centrosomal protein of 55 kDa Up-regulated in colon cancer 6 CEP55 URCC6 C10orf3 protein protein human Homo sapiens Human MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEKEKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIAELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLNQLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVALLEQQMQACTLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK DIP protein Q53EZ4 original sequence version: 39 A652F86EBCE46A51 pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 pdcd6ip-cep55-5 5 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role bait bait Strep-tag Strep-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 799-814 Region 799-814 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human association association pdcd6-1 8 9 unspecified role unspecified role unspecified role unspecified role Region 20-191 Region 20-191 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd6ip-cep55-6 1 10 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 11 unspecified role unspecified role bait bait Strep-tag Strep-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 799-814 Region 799-814 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Pro802Ala P802A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P802A'. Wed May 02 17:15:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro802ala' Tue Jun 30 15:43:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro802Ala' human Homo sapiens Human physical association physical association pdcd6-pdcd6ip-4 2 11 unspecified role unspecified role unspecified role unspecified role Region 799-814 Region 799-814 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role unspecified role unspecified role Region 23-191 Region 23-191 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction pdcd6-pdcd6ip-7 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait O75340:p.Tyr91Ala Y91A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y91A'. Wed May 02 18:31:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr91ala' Tue Jun 30 19:03:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr91Ala' O75340:p.Trp95Ala W95A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W95A'. Wed May 02 19:37:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 18:12:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' O75340:p.Tyr124Ala Y124A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y124A'. Wed May 02 18:13:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr124ala' Tue Jun 30 16:57:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr124Ala' O75340:p.Arg125Ala R125A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R125A'. Wed May 02 15:31:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg125ala' Tue Jun 30 19:39:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg125Ala' O75340:p.Asp169Ala D169A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D169A'. Wed May 02 20:09:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp169ala' Tue Jun 30 17:06:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp169Ala' O75340:p.Tyr180Ala Y180A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y180A'. Wed May 02 19:31:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 19:34:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' O75340:p.Gly121_Phe122del ΔF121/F122 mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GF .. Wed May 02 17:37:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_phe121-122del_del' Tue Jun 30 17:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly121_Phe122del' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association pdcd6ip-pdcd6-1 6 11 unspecified role unspecified role bait bait Region 799-814 Region 799-814 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q8WUM4:p.Pro802Ala P802A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P802A'. Wed May 02 15:29:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro802ala' Tue Jun 30 18:30:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro802Ala' Q8WUM4:p.Tyr803Ala Y803A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y803A'. Wed May 02 17:00:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr803ala' Tue Jun 30 18:31:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr803Ala' Q8WUM4:p.Pro804Ala P804A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P804A'. Wed May 02 17:20:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro804ala' Tue Jun 30 17:07:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro804Ala' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 9 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction pdcd6ip-pdcd6-2 3 11 unspecified role unspecified role bait bait Strep-tag Strep-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association pdcd6ip-pdcd6-3 4 11 unspecified role unspecified role bait bait Q8WUM4:p.Pro802Ala P802A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P802A'. Wed May 02 17:33:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro802ala' Tue Jun 30 18:27:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro802Ala' Q8WUM4:p.Tyr803Ala Y803A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y803A'. Wed May 02 20:33:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr803ala' Tue Jun 30 20:21:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr803Ala' Q8WUM4:p.Pro804Ala P804A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P804A'. Wed May 02 16:28:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro804ala' Tue Jun 30 17:53:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro804Ala' GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 9 unspecified role unspecified role prey prey Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction