DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A role for the two-helix finger of the SecA ATPase in protein translocation. A role for the two-helix finger of the SecA ATPase in protein translocation. Nature 2008 imex curation Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250210X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. A role for the two-helix finger of the SecA ATPase in protein translocation. A role for the two-helix finger of the SecA ATPase in protein translocation. Nature 2008 imex curation Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250209X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. A role for the two-helix finger of the SecA ATPase in protein translocation. A role for the two-helix finger of the SecA ATPase in protein translocation. Nature 2008 imex curation Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Erlandson KJ., Miller SB., Nam Y., Osborne AR., Zimmer J., Rapoport TA. DIP original experiment: DIP-250211X Nature 2008 IMEx A role for the two-helix finger of the SecA ATPase in protein translocation. seca_ecoli Protein translocase subunit SecA secA azi pea prlD b0098 JW0096 protein protein ecoli Escherichia coli (strain K12) MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTPLIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVLIEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHTGRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGGSWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRLQ DIP protein P10408 original sequence version: 150 DIP protein P10408 original sequence version: 130 DIP protein P10408 original sequence version: 105 DIP protein P10408 original sequence version: 107 DIP protein P10408 original sequence version: 125 DIP protein P10408 original sequence version: 140 DIP protein P10408 original sequence version: null 683D66DD4305DBC2 secy_ecoli Protein translocase subunit SecY secY prlA b3300 JW3262 protein protein ecoli Escherichia coli (strain K12) MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPTLAEIKKEGESGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLVLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFASSIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYGR DIP protein P0AGA2 original sequence version: 78 DIP protein P0AGA2 original sequence version: 60 DIP protein P0AGA2 original sequence version: 41 DIP protein P0AGA2 original sequence version: 56 DIP protein P0AGA2 original sequence version: 49 711CA63CD8809763 ompa_ecoli Outer membrane protein A ompA tolG tut con Outer membrane protein II* b0957 JW0940 Outer membrane porin A Outer membrane protein 3A Outer membrane protein B Outer membrane protein d protein protein ecoli Escherichia coli (strain K12) MKKTAIAIAVALAGFATVAQAAPKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA DIP protein P0A910 original sequence version: 81 DIP protein P0A910 original sequence version: 79 DIP protein P0A910 original sequence version: 61 DIP protein P0A910 original sequence version: 54 DIP protein P0A910 original sequence version: 67 DIP protein P0A910 original sequence version: 88 DIP protein P0A910 original sequence version: 93 195147734CDF8B04 ompa-secy-1 2 5 unspecified role unspecified role unspecified role unspecified role P0AGA2:p.Ser282Cys S282C mutation mutation certain certain sequence position certain certain certain sequence position certain S C This feature has been corrected as a result of our quality control procedures. The original label was 'S282C'. Wed May 02 16:45:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser282cys' Tue Jun 30 17:04:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser282Cys' ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role P0A910:p.Gly186Cys G186C mutation mutation certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G186C'. Wed May 02 15:37:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly186cys' Tue Jun 30 18:51:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly186Cys' P0A910:p.Val187Cys V187C mutation mutation certain certain sequence position certain certain certain sequence position certain V C This feature has been corrected as a result of our quality control procedures. The original label was 'V187C'. Wed May 02 19:50:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val187cys' Tue Jun 30 19:11:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val187Cys' P0A910:p.Ser188Cys S188C mutation mutation certain certain sequence position certain certain certain sequence position certain S C This feature has been corrected as a result of our quality control procedures. The original label was 'S188C'. Wed May 02 15:20:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser188cys' Tue Jun 30 19:24:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser188Cys' P0A910:p.Arg190Cys R190C mutation mutation certain certain sequence position certain certain certain sequence position certain R C This feature has been corrected as a result of our quality control procedures. The original label was 'R190C'. Wed May 02 17:22:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg190cys' Tue Jun 30 17:57:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg190Cys' P0A910:p.Phe191Cys F191C mutation mutation certain certain sequence position certain certain certain sequence position certain F C This feature has been corrected as a result of our quality control procedures. The original label was 'F191C'. Wed May 02 18:13:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe191cys' Tue Jun 30 18:14:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe191Cys' P0A910:p.Gly192Cys G192C mutation mutation certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G192C'. Wed May 02 18:59:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly192cys' Tue Jun 30 16:24:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly192Cys' P0A910:p.Gln193Cys Q193C mutation mutation certain certain sequence position certain certain certain sequence position certain Q C This feature has been corrected as a result of our quality control procedures. The original label was 'Q193C'. Wed May 02 16:51:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln193cys' Tue Jun 30 16:50:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln193Cys' P0A910:p.Gly194Cys G194C mutation mutation certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C'. Wed May 02 16:34:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys' Tue Jun 30 17:21:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly194Cys' P0A910:p.Glu195Cys E195C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E195C'. Wed May 02 15:26:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu195cys' Tue Jun 30 18:47:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu195Cys' P0A910:p.Ala196Cys A196C mutation mutation certain certain sequence position certain certain certain sequence position certain A C This feature has been corrected as a result of our quality control procedures. The original label was 'A196C'. Wed May 02 15:02:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala196cys' Tue Jun 30 18:01:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala196Cys' P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A201C'. Wed May 02 20:26:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala201cys' Tue Jun 30 16:22:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala201Cys]' in vitro In vitro direct interaction direct interaction ompa-seca-1 1 4 unspecified role unspecified role unspecified role unspecified role P10408:p.Ala795Cys A759C mutation mutation certain certain sequence position certain certain certain sequence position certain A C Wed May 02 19:30:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala795cys' Tue Jun 30 17:32:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala795Cys' P10408:p.Tyr794Cys Y794C mutation mutation certain certain sequence position certain certain certain sequence position certain Y C This feature has been corrected as a result of our quality control procedures. The original label was 'Y794C'. Wed May 02 19:24:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr794cys' Tue Jun 30 19:17:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr794Cys' P10408:p.Asp798Cys D798C mutation mutation certain certain sequence position certain certain certain sequence position certain D C This feature has been corrected as a result of our quality control procedures. The original label was 'D798C'. Wed May 02 18:14:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp798cys' Tue Jun 30 18:10:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp798Cys' ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role P0AGA2:p.Ser282Cys S282C mutation mutation certain certain sequence position certain certain certain sequence position certain S C This feature has been corrected as a result of our quality control procedures. The original label was 'S282C'. Wed May 02 20:30:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser282cys' Tue Jun 30 17:56:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser282Cys' ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A201C'. Wed May 02 16:55:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala201cys' Tue Jun 30 16:45:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala201Cys]' P0A910:p.[Gly194Cys;Pro202Cys] G194C/P202C mutation mutation certain certain sequence position certain certain certain sequence position certain P C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/P202C'. Wed May 02 20:01:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,pro202cys' Tue Jun 30 17:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Pro202Cys]' P0A910:p.[Gly194Cys;Ala203Cys] G194C/A203C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A203C'. Wed May 02 20:17:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala203cys' Tue Jun 30 19:21:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala203Cys]' P0A910:p.[Gly194Cys;Pro204Cys] G194C/P204C mutation mutation certain certain sequence position certain certain certain sequence position certain P C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/P204C'. Wed May 02 19:21:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,pro204cys' Tue Jun 30 16:49:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Pro204Cys]' P0A910:p.[Gly194Cys;Ala205Cys] G194C/A205C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A205C'. Wed May 02 17:01:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala205cys' Tue Jun 30 20:04:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala205Cys]' in vitro In vitro physical association physical association ompa-seca-2 3 4 unspecified role unspecified role unspecified role unspecified role P10408:p.Ile789Cys I789C mutation mutation certain certain sequence position certain certain certain sequence position certain I C This feature has been corrected as a result of our quality control procedures. The original label was 'I789C'. Wed May 02 14:59:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile789cys' Tue Jun 30 18:00:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile789Cys' P10408:p.Tyr794Cys Y794C mutation mutation certain certain sequence position certain certain certain sequence position certain Y C This feature has been corrected as a result of our quality control procedures. The original label was 'Y794C'. Wed May 02 19:46:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr794cys' Tue Jun 30 20:00:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr794Cys' P10408:p.Ala795Cys A759C mutation mutation certain certain sequence position certain certain certain sequence position certain A C Fri Jul 28 10:43:43 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'A759C' Wed May 02 19:20:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala795cys' Tue Jun 30 19:13:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala795Cys' P10408:p.Lys797Cys K797C mutation mutation certain certain sequence position certain certain certain sequence position certain K C This feature has been corrected as a result of our quality control procedures. The original label was 'K797C'. Wed May 02 18:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys797cys' Tue Jun 30 17:38:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys797Cys' P10408:p.Asp798Cys D798C mutation mutation certain certain sequence position certain certain certain sequence position certain D C This feature has been corrected as a result of our quality control procedures. The original label was 'D798C'. Wed May 02 16:58:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp798cys' Tue Jun 30 18:10:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp798Cys' P10408:p.Gln801Cys Q801C mutation mutation certain certain sequence position certain certain certain sequence position certain Q C This feature has been corrected as a result of our quality control procedures. The original label was 'Q801C'. Wed May 02 14:46:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln801cys' Tue Jun 30 18:57:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln801Cys' P10408:p.Glu802Cys E802C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E802C'. Wed May 02 20:00:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu802cys' Tue Jun 30 16:20:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu802Cys' ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role P0A910:p.[Gly194Cys;Ala205Cys] G194C/A205C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A205C'. Wed May 02 16:23:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala205cys' Tue Jun 30 19:50:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala205Cys]' P0A910:p.[Gly194Cys;Pro204Cys] G194C/P204C mutation mutation certain certain sequence position certain certain certain sequence position certain P C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/P204C'. Wed May 02 14:39:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,pro204cys' Tue Jun 30 17:26:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Pro204Cys]' P0A910:p.[Gly194Cys;Ala203Cys] G194C/A203C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A203C'. Wed May 02 15:56:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala203cys' Tue Jun 30 18:02:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala203Cys]' P0A910:p.[Gly194Cys;Pro202Cys] G194C/P202C mutation mutation certain certain sequence position certain certain certain sequence position certain P C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/P202C'. Wed May 02 18:08:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,pro202cys' Tue Jun 30 20:24:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Pro202Cys]' P0A910:p.[Gly194Cys;Ala201Cys] G194C/A201C mutation mutation certain certain sequence position certain certain certain sequence position certain A C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/A201C'. Wed May 02 19:15:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,ala201cys' Tue Jun 30 19:42:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Ala201Cys]' P0A910:p.[Gly194Cys;Pro198Cys] G194C/P198C mutation mutation certain certain sequence position certain certain certain sequence position certain P C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/P198C'. Wed May 02 14:48:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,pro198cys' Tue Jun 30 18:32:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Pro198Cys]' P0A910:p.[Gly194Cys;Val199Cys] G194C/V199C mutation mutation certain certain sequence position certain certain certain sequence position certain V C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/V199C'. Wed May 02 18:26:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,val199cys' Tue Jun 30 17:18:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Val199Cys]' P0A910:p.[Gly194Cys;Val200Cys] G194C/V200C mutation mutation certain certain sequence position certain certain certain sequence position certain V C certain certain sequence position certain certain certain sequence position certain G C This feature has been corrected as a result of our quality control procedures. The original label was 'G194C/V200C'. Wed May 02 14:57:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly194cys,val200cys' Tue Jun 30 18:20:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly194Cys;Val200Cys]' in vitro In vitro direct interaction direct interaction