DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. DIP original experiment: DIP-113429X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boukerche H., Su ZZ., Prévot C., Sarkar D., Fisher PB. DIP original experiment: DIP-113430X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src. src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P12931 original sequence version: 188 DIP protein P12931 original sequence version: 189 DIP protein P12931 original sequence version: 190 DIP protein P12931 original sequence version: 191 DIP protein P12931 original sequence version: 115 DIP protein P12931 original sequence version: 116 DIP protein P12931 original sequence version: 164 DIP protein P12931 original sequence version: 142 DIP protein P12931 original sequence version: 143 DIP protein P12931 original sequence version: 150 DIP protein P12931 original sequence version: 160 DIP protein P12931 original sequence version: 184 DIP protein P12931 original sequence version: 155 DIP protein P12931-1 original sequence version: 155 DIP protein P12931 original sequence version: 202 C1908084683E5DE8 sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV DIP protein O00560 original sequence version: 87 DIP protein O00560-1 original sequence version: 117 574E1349F86F949F sdcbp-src-1 1 3 unspecified role unspecified role prey prey human Homo sapiens Human 4 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association src-sdcbp-1 2 4 unspecified role unspecified role prey prey human Homo sapiens Human 3 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association