IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. tostakai@idac.tohoku.ac.jp 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions human-macrophage Human macrophages macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. Macrophages were obtained by 7 days of culture of CD14+ monocytes in medium containing M-CSF but not RANKL. tostakai@idac.tohoku.ac.jp Accepted 2017-JUL-13 AT 08:18 BST AT 08:18 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. tostakai@idac.tohoku.ac.jp 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions human-osteoclast Homo sapiens osteoclast Osteoclast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. "MOCS":multinucleated mature osteoclasts obtained by 7 day culture in the presence of RANKL and M-CSF. tostakai@idac.tohoku.ac.jp Accepted 2017-JUL-13 AT 08:18 BST AT 08:18 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. tostakai@idac.tohoku.ac.jp 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. tostakai@idac.tohoku.ac.jp Accepted 2017-JUL-13 AT 08:18 BST AT 08:18 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development. Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. tostakai@idac.tohoku.ac.jp 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions human-osteoclast Homo sapiens osteoclast Osteoclast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T., Mori Y., Tsuji S., Inui M., Sakamoto Y., Endo S., Ito Y., Fujimura S., Koga T., Nakamura A., Takayanagi H., Itoi E., Takai T. Fig 2A:I have not added phospho-tyrosine PTM to LILRB proteins as although they state they are phoph-ed there are no complete blots shown - so ... Cannot annotate any FRETs as they use fluorescent dye conjugated antibodies - that are non-specific. "POCS":Prefusion or nonfused osteoclasts obtained by 72 h of culture in the presence of RANKL and M-CSF. tostakai@idac.tohoku.ac.jp Accepted 2017-JUL-13 AT 08:18 BST AT 08:18 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation lirb3_human Leukocyte immunoglobulin-like receptor subfamily B member 3 LILRB3 ILT5 LIR3 CD85 antigen-like family member A Immunoglobulin-like transcript 5 Monocyte inhibitory receptor HL9 protein protein human Homo sapiens Human MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH 595B1BD5283A7E3E lirb2_human Leukocyte immunoglobulin-like receptor subfamily B member 2 LILRB2 ILT4 LIR2 MIR10 CD85 antigen-like family member D Immunoglobulin-like transcript 4 Monocyte/macrophage immunoglobulin-like receptor 10 protein protein human Homo sapiens Human MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH DIP protein Q8N423 original sequence version: 127 DIP protein Q8N423 original sequence version: 104 33E9737AFCAFCE2D ptn6_human Tyrosine-protein phosphatase non-receptor type 6 PTPN6 HCP Protein-tyrosine phosphatase 1C Hematopoietic cell protein-tyrosine phosphatase SH-PTP1 Protein-tyrosine phosphatase SHP-1 PTP1C protein protein human Homo sapiens Human MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK DIP protein P29350 original sequence version: 183 DIP protein P29350 original sequence version: 139 DIP protein P29350-1 original sequence version: 139 4D7736C21D3542D2 lirb1_human Leukocyte immunoglobulin-like receptor subfamily B member 1 ILT2 LIR1 MIR7 CD85 antigen-like family member J Immunoglobulin-like transcript 2 Monocyte/macrophage immunoglobulin-like receptor 7 LILRB1 protein protein human Homo sapiens Human MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH 549196EA4ED2767C lirb4_human Leukocyte immunoglobulin-like receptor subfamily B member 4 ILT3 LIR5 CD85 antigen-like family member K Immunoglobulin-like transcript 3 Leukocyte immunoglobulin-like receptor 5 Monocyte inhibitory receptor HM18 LILRB4 protein protein human Homo sapiens Human MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEDPRPSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH C18C21694F283FBB lilrb1-ptpn6-4 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2A-1 lilrb1-ptpn6-1 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-2 lilrb1-ptpn6-2 4 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-3 lilrb1-ptpn6-3 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-4 lilrb1-ptpn6-5 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2A-5 lilrb1-ptpn6-6 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-6 lilrb1-ptpn6-7 4 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-7 lilrb1-ptpn6-8 2 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-8 lilrb3-ptpn6-1 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2A-9 weak reaction lilrb3-ptpn6-2 1 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-10 lilrb3-ptpn6-3 4 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-11 lilrb3-ptpn6-4 2 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-12 lilrb4-ptpn6-1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-13 lilrb4-ptpn6-2 4 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-14 lilrb4-ptpn6-3 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 2A-15