DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu RIM1alpha phosphorylation at serine-413 by protein kinase A is not required for presynaptic long-term plasticity or learning. RIM1alpha phosphorylation at serine-413 by protein kinase A is not required for presynaptic long-term plasticity or learning. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Kaeser PS., Kwon HB., Blundell J., Chevaleyre V., Morishita W., Malenka RC., Powell CM., Castillo PE., Südhof TC. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kaeser PS., Kwon HB., Blundell J., Chevaleyre V., Morishita W., Malenka RC., Powell CM., Castillo PE., Südhof TC. DIP original experiment: DIP-133381X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx RIM1alpha phosphorylation at serine-413 by protein kinase A is not required for presynaptic long-term plasticity or learning. RIM1alpha phosphorylation at serine-413 by protein kinase A is not required for presynaptic long-term plasticity or learning. RIM1alpha phosphorylation at serine-413 by protein kinase A is not required for presynaptic long-term plasticity or learning. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Kaeser PS., Kwon HB., Blundell J., Chevaleyre V., Morishita W., Malenka RC., Powell CM., Castillo PE., Südhof TC. Only protein-protein interactions in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Kaeser PS., Kwon HB., Blundell J., Chevaleyre V., Morishita W., Malenka RC., Powell CM., Castillo PE., Südhof TC. DIP original experiment: DIP-133380X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.1 1433z_rat 14-3-3 protein zeta/delta Ywhaz Msfs1 Protein kinase C inhibitor protein 1 Mitochondrial import stimulation factor S1 subunit protein protein rat Rattus norvegicus (Rat) Rat MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63102 original sequence version: 65 2164DF3793B45B7A rims1_rat Regulating synaptic membrane exocytosis protein 1 Rims1 Rim1 Rab-3-interacting molecule 1 protein protein rat Rattus norvegicus (Rat) Rat MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTPRNAESQPHQPPLNIFRCVCVPRKPSSEEGGPERDWRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAVSSQDTATPGAPLHRNKGAEPSQQALGPEQKQASRSRSEPPRERKKAPGLSEQNGKGGQKSERKRVPKSVVQPGEGIADERERKERRETRRLEKGRSQDYSDRPEKRDNGRVAEDQKQRKEEEYQTRYRSDPNLARYPVKAPPEEQQMRMHARVSRARHERRHSDVALPHTEAAAAAPAEATAGKRAPATARVSPPESPRARAAAAQPPTEHGPPPPRPAPGPAEPPEPRVPEPLRKQGRLDPGSAVLLRKAKREKAESMLRNDSLSSDQSESVRPSPPKPHRPKRGGKRRQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKGDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKLLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQDEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQRSQRISDSDISDYEVDDGIGVVPPVGYRASARESKATTLTVPEQQRTTHHRSRSVSPHRGDDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPADHRSRHVESQYSSEPDSELLMLPRAKRGRSAESLHMTSELQPSLDRARSASTNCLRPDTSLHSPERERHSRKSERCSIQKQSRKGTASDADRVLPPCLSRRGYATPRATDQPVVRGKYPTRSRSSEHSSVRTLCSMHHLAPGGSAPPSPLLLTRTHRQGSPTQSPPADTSFGSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKVKVHRFKQTTGSGSSQELDHEQYSKYNIHKDQYRSCDNASAKSSDSDVSDVSAISRASSTSRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRAIIKSTSVSGEIYTLERNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRVGPDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSSGPPCIRS DIP protein Q9JIR4 original sequence version: 83 80E76F74BF35FB7E 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62260 original sequence version: 67 07817CCBD1F75B26 1433f_rat 14-3-3 protein eta Ywhah protein protein rat Rattus norvegicus (Rat) Rat MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein P68511 original sequence version: 56 C12F62B4ABA76DA3 rims1-ywhae-1 2 3 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 6 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 5 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 4 unspecified role unspecified role bait bait Gst tag Gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range 351-596 bining site 351-596 bining site sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association rims1-ywhae-2 1 3 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 5 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 4 unspecified role unspecified role bait bait binding site 351-429 binding site 351-429 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain binding site 351-596 binding site 351-596 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain Gst tag Gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association