DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Nature structural & molecular biology 2008 imex curation Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. DIP original experiment: DIP-132448X Nature structural & molecular biology 2008 IMEx Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Nature structural & molecular biology 2008 imex curation Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. Only protein-protein interactions ecolx Escherichia coli pull down pull down anti tag western anti tag western blot anti tag western Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. DIP original experiment: DIP-132449X Nature structural & molecular biology 2008 IMEx Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Nature structural & molecular biology 2008 imex curation Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. Only protein-protein interactions in vitro In vitro protease assay protease assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. DIP original experiment: DIP-132450X Nature structural & molecular biology 2008 IMEx Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Nature structural & molecular biology 2008 imex curation Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. Only protein-protein interactions in vitro In vitro protease assay protease assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. DIP original experiment: DIP-132451X Nature structural & molecular biology 2008 IMEx Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. Nature structural & molecular biology 2008 imex curation Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. Only protein-protein interactions in vitro In vitro protease assay protease assay tag visualisation by mutated dna adenine methyltransferase tag visualisation by mutated dna adenine methyltransferase Geng X., Shi Y., Nakagawa A., Yoshina S., Mitani S., Shi Y., Xue D. DIP original experiment: DIP-132450X Nature structural & molecular biology 2008 IMEx Inhibition of CED-3 zymogen activation and apoptosis in Caenorhabditis elegans by caspase homolog CSP-3. ced3_caeel Cell death protein 3 ced-3 Caspase ced-3 C48D1.2 protein protein caeel Caenorhabditis elegans MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQMPEMTSRLLKKFYFWPEARNSAV DIP protein P42573 original sequence version: 122 DIP protein P42573 original sequence version: 131 DIP protein P42573 original sequence version: 85 722D5831F94DAA69 ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK DIP protein P41958 original sequence version: 125 DIP protein P41958 original sequence version: 83 7603675E490DD3EB csp3_caeel Non-catalytic caspase homolog csp-3 csp-3 Y47H9C.6 protein protein caeel Caenorhabditis elegans MFFGKLGGFAFFLQRAVRCDGFIDNFFDRIPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFKDETKDTWYIQELYRVIIENAKDTHLADLLTETNRRVVEKYEADKVVFVCKQAPEFWSRFTKQLFFMSRNDVF ced_3-csp3-1 1 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range caeel Caenorhabditis elegans 8 unspecified role unspecified role prey prey caeel Caenorhabditis elegans physical association physical association ced_3-csp3-2 3 6 putative self putative self putative self putative self in vitro In vitro 8 unspecified role unspecified role unspecified role unspecified role G5ECW5:p.Phe57Asp F57D mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D Wed May 02 20:21:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe57asp' Tue Jun 30 17:40:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe57Asp' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction csp3-ced_3-1 2 6 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-371 Region 1-371 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role bait bait G5ECW5:p.Phe57Asp F57D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F D Wed May 02 16:28:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe57asp' Tue Jun 30 15:41:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe57Asp' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ced_3-ced_9-2 4 7 enzyme target enzyme target substrate substrate unspecified role unspecified role in vitro In vitro 6 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli cleavage cleavage reaction cleavage ced_3-1 5 6 acceptor acceptor ancillary ancillary protein cleavage protein cleavage