DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of bovine mitochondrial factor B at 0.96-A resolution. Crystal structure of bovine mitochondrial factor B at 0.96-A resolution. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Lee JK., Belogrudov GI., Stroud RM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee JK., Belogrudov GI., Stroud RM. DIP original experiment: DIP-113383X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of bovine mitochondrial factor B at 0.96-A resolution. atp5s_bovin ATP synthase subunit s, mitochondrial DMAC2L ATP synthase-coupling factor B ATP5S ATPW Distal membrane arm assembly complex 2-like protein Mitochondrial ATP synthase regulatory component factor B protein protein bovin Bos taurus (Bovine) Bovine MMLFGKISQQLCGLKKLPWSRDSRYFWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK DIP protein P22027 original sequence version: 53 atp5s-1 1 2 unspecified role unspecified role unspecified role unspecified role P22027:p.Gly28Glu G28E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E This feature has been corrected as a result of our quality control procedures. The original label was 'G28E'. Wed May 02 16:09:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly28glu' Tue Jun 30 17:46:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly28Glu' ecolx Escherichia coli direct interaction direct interaction