DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. DIP original experiment: DIP-113374X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. Only protein-protein interactions human Homo sapiens Human bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. DIP original experiment: DIP-113372X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. DIP original experiment: DIP-113371X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Plaza S., Prince F., Adachi Y., Punzo C., Cribbs DL., Gehring WJ. DIP original experiment: DIP-113373X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Cross-regulatory protein-protein interactions between Hox and Pax transcription factors. p02833-1 Homeotic protein antennapedia Antp CG1028 A B I J protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ DIP protein P02833-1 original sequence version: 101 pax6_drome Paired box protein Pax-6 ey pax6 CG1464 Protein eyeless protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRNLPCLGTAGGSGLGGIAGKPSPTMEAVEASTASHRHSTSSYFATTYYHLTDDECHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQSTGSGSSSTSAGNSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNSSESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFGAMYSNMHHTALSMSDSYGAVTPIPSFNHSAVGPLAPPSPIPQQGDLTPSSLYPCHMTLRPPPMAPAHHHIVPGDGGRPAGVGLGSGQSANLGASCSGSGYEVLSAYALPPPPMASSSAADSSFSAASSASANVTPHHTIAQESCPSPCSSASHFGVAHSSGFSSDPISPAVSSYAHMSYNYASSANTMTPSSASGTSAHVAPGKQQFFASCFYSPWV DIP protein O18381 original sequence version: 91 8EC3BA2F4C066269 antp-ey-1 3 5 unspecified role unspecified role bait bait Region 268-378 Region 268-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 26-172 Region 26-172 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 410-473 Region 410-473 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction ey-antp-1 4 5 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait Region 26-172 Region 26-172 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction antp-ey-2 2 5 unspecified role unspecified role unspecified role unspecified role Region 268-378 Region 268-378 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 6 unspecified role unspecified role unspecified role unspecified role Region 26-172 Region 26-172 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 410-473 Region 410-473 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction antp-ey-3 1 5 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role unspecified role unspecified role drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction