DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Membrane curvature induced by Arf1-GTP is essential for vesicle formation. Membrane curvature induced by Arf1-GTP is essential for vesicle formation. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Beck R., Sun Z., Adolf F., Rutz C., Bassler J., Wild K., Sinning I., Hurt E., Brügger B., Béthune J., Wieland F. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Beck R., Sun Z., Adolf F., Rutz C., Bassler J., Wild K., Sinning I., Hurt E., Brügger B., Béthune J., Wieland F. DIP original experiment: DIP-113279X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Membrane curvature induced by Arf1-GTP is essential for vesicle formation. arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK DIP protein P84077 original sequence version: 122 DIP protein P84077 original sequence version: 56 DIP protein P84077 original sequence version: 89 AAC773D4A60186B6 arf1-5 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction