DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. Nature 2008 imex curation Rehmann H., Arias-Palomo E., Hadders MA., Schwede F., Llorca O., Bos JL. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Rehmann H., Arias-Palomo E., Hadders MA., Schwede F., Llorca O., Bos JL. DIP original experiment: DIP-250242X Nature 2008 IMEx Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. Nature 2008 imex curation Rehmann H., Arias-Palomo E., Hadders MA., Schwede F., Llorca O., Bos JL. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rehmann H., Arias-Palomo E., Hadders MA., Schwede F., Llorca O., Bos JL. DIP original experiment: DIP-250241X Nature 2008 IMEx Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B. q9eqz6-3 Rap guanine nucleotide exchange factor 4 Rapgef4 Cgef2 Epac2 Exchange factor directly activated by cAMP 2 Exchange protein directly activated by cAMP 2 cAMP-dependent Rap1 guanine-nucleotide exchange factor cAMP-regulated guanine nucleotide exchange factor II protein protein mouse Mus musculus Mouse MVAAHAAHSQSSAEWIACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENVPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMIQQTSCVHSRTQAVGMWQVLLEDGVLNHVDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPSLNEATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMAFLEEFYVSVSDDARMMAAFKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCIDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGEKVVLKSNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTAAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP DIP protein Q9EQZ6-3 original sequence version: 116 DIP protein Q9EQZ6-3 original sequence version: 67 Produced by alternative splicing of isoform 1. No experimental confirmation available. rap1b_human Ras-related protein Rap-1b OK/SW-cl.11 RAP1B GTP-binding protein smg p21B protein protein human Homo sapiens Human MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL DIP protein P61224 original sequence version: 116 DIP protein P61224 original sequence version: 107 CE976895E5965224 rap1b-rapgef4-2 2 4 unspecified role unspecified role unspecified role unspecified role Region 1-167 Region 1-167 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Region 306-993 Region 306-993 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction rap1b-rapgef4-3 1 4 unspecified role unspecified role unspecified role unspecified role Region 1-167 Region 1-167 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction