DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111234X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111235X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111236X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Jansson D., Ng AC., Fu A., Depatie C., Al Azzabi M., Screaton RA. DIP original experiment: DIP-111233X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Glucose controls CREB activity in islet cells via regulated phosphorylation of TORC2. mark3_human MAP/microtubule affinity-regulating kinase 3 Cdc25C-associated protein kinase 1 C-TAK1 Serine/threonine-protein kinase p78 Ser/Thr protein kinase PAR-1 Protein kinase STK10 MARK3 CTAK1 EMK2 ELKL motif kinase 2 protein protein human Homo sapiens Human MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL DIP protein P27448 original sequence version: 92 DIP protein P27448 original sequence version: 95 B50B3C145E896B0B 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 crtc2_mouse CREB-regulated transcription coactivator 2 Torc2 Crtc2 Transducer of regulated cAMP response element-binding protein 2 protein protein mouse Mus musculus Mouse MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDARRMVSPLRRYPRHIDSSPYSPAYLSPPPESGWRRMMPWGNLPAEKGQLFRLPSALNRTSSDSALHTSVMNPNPQDTYPGPTPPSVLPSRRGGGFLDGEMDAKVPAIEENVVDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETVYPSLSGGNSTTNLTHTMTHLGISGGLGLGPSYDVPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLAHHALPTTSLGHPSLSAPALSSSSSSSSTSSPVLSAPPYPASTPGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLPTDQRLPPYPYSPPSLVIPTHPPTPKSLQQLPSQACLVQPSGGQPPGRQPHYGALYPPGSSGHGQQPYHRPINDFSLGNLEQFNMESPSTSLVLDPPAFSEGPGFLGSEGSMSGPQDPHVLNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEPLGLEGLTMLSDPCALLPDPAVEDSFRSDRLQ DIP protein Q3U182 original sequence version: 23 DIP protein Q3U182 original sequence version: 54 DIP protein Q3U182 original sequence version: 64 DIP protein Q3U182 original sequence version: 52 Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells mint 5BCBC416D45CFAD8 mark2_human Serine/threonine-protein kinase MARK2 MAP/microtubule affinity-regulating kinase 2 ELKL motif kinase 1 PAR1 homolog MARK2 EMK1 PAR1 homolog b protein protein human Homo sapiens Human MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMSASVHPNKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL DIP protein Q7KZI7 original sequence version: 53 DIP protein Q7KZI7 original sequence version: 76 DIP protein Q7KZI7 original sequence version: 70 F307BF4DDB543A70 aapk1_human 5'-AMP-activated protein kinase catalytic subunit alpha-1 PRKAA1 AMPK1 Tau-protein kinase PRKAA1 Acetyl-CoA carboxylase kinase Hydroxymethylglutaryl-CoA reductase kinase protein protein human Homo sapiens Human MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ DIP protein Q13131 original sequence version: 149 DIP protein Q13131 original sequence version: 91 DIP protein Q13131 original sequence version: 165 DIP protein Q13131 original sequence version: 164 ABAE71FBF912947A crtc2-ywhab-1 4 7 unspecified role unspecified role bait bait Region 1-321 Region 1-321 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S171A'. Wed May 02 17:14:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser171ala' Tue Jun 30 20:17:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser171Ala' Q3U182:p.[Ser171Ala;Ser275Ala] S171A/S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S171A/S275A'. Wed May 02 17:50:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser171ala,ser275ala' Tue Jun 30 20:08:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser171Ala;Ser275Ala]' human Homo sapiens Human 6 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction crtc2-mark2-1 2 7 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S171A'. Wed May 02 14:38:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser171ala' Tue Jun 30 16:21:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser171Ala' Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S275A'. Wed May 02 20:31:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275ala' Tue Jun 30 17:37:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser275Ala' Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction crtc2-prkaa1-1 1 7 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S171A'. Wed May 02 18:45:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser171ala' Tue Jun 30 17:55:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser171Ala' Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S275A'. Wed May 02 18:29:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275ala' Tue Jun 30 18:55:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser275Ala' Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction crtc2-mark3-1 3 7 enzyme target enzyme target substrate substrate unspecified role unspecified role Q3U182:p.Ser171Ala S171A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S171A'. Wed May 02 19:00:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser171ala' Tue Jun 30 18:20:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser171Ala' Q3U182:p.Ser275Ala S275A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S275A'. Wed May 02 18:34:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser275ala' Tue Jun 30 15:50:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser275Ala' Region 161-179 Region 161-179 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Region 267-283 Region 267-283 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 enzyme enzyme unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction