DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111223X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-252200X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-252201X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111220X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111219X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111224X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111222X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schütz P., Bumann M., Oberholzer AE., Bieniossek C., Trachsel H., Altmann M., Baumann U. DIP original experiment: DIP-111221X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Crystal structure of the yeast eIF4A-eIF4G complex: an RNA-helicase controlled by protein-protein interactions. q04637-1 Eukaryotic translation initiation factor 4 gamma 1 EIF4G1 EIF4F EIF4G EIF4GI p220 protein protein human Homo sapiens Human MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPSSAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQYPVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAIIADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEESTPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGINCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVLMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKVQQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRVVQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQPEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMKEAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVDVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN DIP protein Q04637-1 original sequence version: 94 324088B60863DA34 if4a1_human Eukaryotic initiation factor 4A-I EIF4A1 EIF4A DDX2A ATP-dependent RNA helicase eIF4A-1 protein protein human Homo sapiens Human MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI DIP protein P60842 original sequence version: 125 DIP protein P60842 original sequence version: 59 DIP protein P60842 original sequence version: 63 DIP protein P60842 original sequence version: 85 DIP protein P60842 original sequence version: 86 DIP protein P60842 original sequence version: 92 DIP protein P60842-1 original sequence version: 114 DIP protein P60842 original sequence version: 106 6EF89939F3045420 if4f1_yeast Eukaryotic initiation factor 4F subunit p150 YGR162W TIF4631 eIF4G1 mRNA cap-binding protein complex subunit p150 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDETAHPTQSASKQESAALKQTGDDQQESQQQRGYTNYNNGSNYTQKKPYNSNRPHQQRGGKFGPNRYNNRGNYNGGGSFRGGHMGANSSNVPWTGYYNNYPVYYQPQQMAAAGSAPANPIPVEEKSPVPTKIEITTKSGEHLDLKEQHKAKLQSQERSTVSPQPESKLKETSDSTSTSTPTPTPSTNDSKASSEENISEAEKTRRNFIEQVKLRKAALEKKRKEQLEGSSGNNNIPMKTTPENVEEKGSDKPEVTEKTKPAEEKSAEPEVKQETPAEEGEQGEKGQIKEESTPKVLTFAERLKLKKQQKEREEKTEGKENKEVPVQEETKSAIESAPVPPSEQVKEETEVAETEQSNIDESATTPAIPTKSDEAEAEVEAEAGDAGTKIGLEAEIETTTDETDDGTNTVSHILNVLKDATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKIVIPPGMGRGNRSRDSGRFGNNSSRGHDFRNTSVRNMDDRANSRTSSKRRSKRMNDDRRSNRSYTSRRDRERGSYRNEEKREDDKPKEEVAPLVPSANRWVPKFKSKKTEKKLAPDGKTELLDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKLIDIKELRHDKNWNSDKKDNGPKTIQQIHEEEERQRQLKNNSRSNSRRTNNSSNRHSFRRDAPPASKDSFITTRTYSQRNSQRAPPPKEEPAAPTSTATNMFSALMGESDDEE 391256802F86118E 391256802F86118E if4g1_human Eukaryotic translation initiation factor 4 gamma 1 p220 EIF4G1 EIF4G EIF4GI EIF4F protein protein human Homo sapiens Human MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPSSAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQYPVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAIIADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEESTPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGINCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVLMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKVQQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRVVQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQPEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMKEAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVDVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN DIP protein Q04637 original sequence version: 68 DIP protein Q04637 original sequence version: 166 DIP protein Q04637 original sequence version: 160 DIP protein Q04637-1 original sequence version: 94 DIP protein Q04637 original sequence version: 115 DIP protein Q04637 original sequence version: 119 DIP protein Q04637 original sequence version: 146 DIP protein Q04637-1 original sequence version: 148 DIP protein Q04637 original sequence version: 150 324088B60863DA34 if4a_yeast ATP-dependent RNA helicase eIF4A Stimulator factor I 37 kDa component TIF41A TIF41B Translation initiation factor 1/2 J0660 YJL138C YKR059W TIF1 TIF2 Eukaryotic initiation factor 4A p37 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN 19D8C133C815DD48 19D8C133C815DD48 yeif4a-yeif4g1-1 5 11 unspecified role unspecified role unspecified role unspecified role Region 572-853 Region 572-853 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 226-395 Region 226-395 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction yeif4a-yeif4g1-2 8 11 unspecified role unspecified role prey prey Region 572-853 Region 572-853 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role bait bait Region 226-395 Region 226-395 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction yeif4a-yeif4g1-3 1 11 unspecified role unspecified role unspecified role unspecified role Region 572-853 Region 572-853 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role Region 226-395 Region 226-395 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction yeif4a-yeif4g1-4 7 11 unspecified role unspecified role unspecified role unspecified role Region 572-853 Region 572-853 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction eif4a1-eif4g1-2 4 9 unspecified role unspecified role unspecified role unspecified role Region 710-970 Region 710-970 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction eif4a1-eif4g1-3 6 9 unspecified role unspecified role unspecified role unspecified role Region 710-970 Region 710-970 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction eif4a1-eif4g1-4 2 12 unspecified role unspecified role unspecified role unspecified role Region 710-970 Region 710-970 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2013-08-04 eif4a1-eif4g1-5 3 12 unspecified role unspecified role unspecified role unspecified role Region 710-970 Region 710-970 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 1 nodeMerge04 2013-08-04