DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113783X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113778X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113809X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113800X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113760X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113795X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113777X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113808X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113793X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113805X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113774X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113773X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113764X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113769X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113770X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113790X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113803X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113780X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113786X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113772X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113794X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113765X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113785X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113798X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113796X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113776X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113812X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113767X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113792X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113775X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113768X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113799X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113788X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113759X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113779X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113781X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113784X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113766X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113787X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113802X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113810X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113771X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113801X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113813X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113811X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113806X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113763X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113791X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113762X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113804X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113807X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113761X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113789X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions human Homo sapiens Human ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113782X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhou M., Sandercock AM., Fraser CS., Ridlova G., Stephens E., Schenauer MR., Yokoi-Fong T., Barsky D., Leary JA., Hershey JW., Doudna JA., Robinson CV. DIP original experiment: DIP-113797X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3. eif3e_human Eukaryotic translation initiation factor 3 subunit E EIF3E INT6 EIF3S6 Eukaryotic translation initiation factor 3 subunit 6 eIF-3 p48 Viral integration site protein INT-6 homolog protein protein human Homo sapiens Human MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY DIP protein P60228 original sequence version: 120 DIP protein P60228 original sequence version: 60 DIP protein P60228 original sequence version: 76 DIP protein P60228 original sequence version: 111 A5368651DD0DDD0C eif3i_yeast Eukaryotic translation initiation factor 3 subunit I TIF34 YMR146C YM9375.16C Eukaryotic translation initiation factor 3 39 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN E6C0D0B275E87622 E6C0D0B275E87622 eif3g_yeast Eukaryotic translation initiation factor 3 subunit G TIF35 YDR429C D9461.16 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPKVKE 340A5285F2C84E06 340A5285F2C84E06 eif3a_yeast Eukaryotic translation initiation factor 3 subunit A RPG1 TIF32 YBR079C YBR0734 Eukaryotic translation initiation factor 3 110 kDa subunit homolog Translation initiation factor eIF3, p110 subunit homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPPPFRPENAIKRADELISVGEKQAALQSLHDFITARRIRWATPSTVEPVVFKFLEIGVELKKGKLLKDGLHQYKKLIQGSTEGLVSVGAVARKFIDLVESKIASEQTRADELQKQEIDDDLEGGVTPENLLISVYESDQSVAGFNDEAITSWLRFTWESYRAVLDLLRNNALLEITYSGVVKKTMHFCLKYQRKNEFKRLAEMLRQHLDAANYQQSKSGNNLVDLSDADTLQRYLDQRFQQVDVSVKLELWHEAYRSIEDVFHLMKISKRAPKPSTLANYYENLVKVFFVSGDPLLHTTAWKKFYKLYSTNPRATEEEFKTYSSTIFLSAISTQLDEIPSIGYDPHLRMYRLLNLDAKPTRKEMLQSIIEDESIYGKVDEELKELYDIIEVNFDVDTVKQQLENLLVKLSSKTYFSQYIAPLRDVIMRRVFVAASQKFTTVSQSELYKLATLPAPLDLSAWDIEKSLLQAAVEDYVSITIDHESAKVTFAKDPFDIFASTASKEVSEEENTEPEVQEEKEETDEALGPQETEDGEEKEEESDPVIIRNSYIHNKLLELSNVLHDVDSFNNASYMEKVRIARETLIKKNKDDLEKISKIVDERVKRSQEQKQKHMEHAALHAEQDAEVRQQRILEEKAAIEAKLEEEAHRRLIEKKKREFEAIKEREITKMITEVNAKGHVYIDPNEAKSLDLDTIKQVIIAEVSKNKSELESRMEYAMKKLDHTERALRKVELPLLQKEVDKLQETDTANYEAMKKKIVDAAKAEYEARMADRKNLVMVYDDYLKFKEHVSGTKESELAAIRNQKKAELEAAKKARIEEVRKRRYEEAIARRKEEIANAERQKRAQELAEATRKQREIEEAAAKKSTPYSFRAGNREPPSTPSTLPKATVSPDKAKLDMIAQKQREMEEAIEQRLAGRTAGGSSPATPATPATPATPTPSSGPKKMTMAEKLRAKRLAKGGR 93EFFA6B2FC8286D 93EFFA6B2FC8286D eif3f_human Eukaryotic translation initiation factor 3 subunit F Eukaryotic translation initiation factor 3 subunit 5 eIF-3-epsilon eIF3 p47 EIF3F EIF3S5 Deubiquitinating enzyme eIF3f protein protein human Homo sapiens Human MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL DIP protein O00303 original sequence version: 142 DIP protein O00303 original sequence version: 80 DIP protein O00303 original sequence version: 95 DIP protein O00303 original sequence version: 126 8A70FC6E2BF07737 eif3m_human Eukaryotic translation initiation factor 3 subunit M EIF3M HFLB5 PCID1 PCI domain-containing protein 1 Fetal lung protein B5 GA17 PNAS-125 protein protein human Homo sapiens Human MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT DIP protein Q7L2H7 original sequence version: 33 DIP protein Q7L2H7 original sequence version: 48 DIP protein Q7L2H7 original sequence version: 79 63736CA2B093D794 eif3b_human Eukaryotic translation initiation factor 3 subunit B Eukaryotic translation initiation factor 3 subunit 9 eIF-3-eta eIF3 p116 eIF3 p110 Prt1 homolog EIF3B EIF3S9 protein protein human Homo sapiens Human MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE DIP protein P55884 original sequence version: 84 C687A986EDAE0F5E eif3a_human Eukaryotic translation initiation factor 3 subunit A EIF3A KIAA0139 EIF3S10 Eukaryotic translation initiation factor 3 subunit 10 eIF-3-theta eIF3 p167 eIF3 p180 eIF3 p185 protein protein human Homo sapiens Human MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDNIQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQAFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSAISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEKEPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFEERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEELREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWRKGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDREPSLRPDDDRVPRRGMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGNWRHADDDRPPRRGLDEDRGSWRTADEDRGPRRGMDDDRGPRRGGADDERSSWRNADDDRGPRRGLDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPRRGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWGPPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSWRRADDRKDDRVEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKNETDEDGWTTVRR DIP protein Q14152 original sequence version: 79 DIP protein Q14152 original sequence version: 130 DIP protein Q14152 original sequence version: 111 DIP protein Q14152 original sequence version: 104 485C01B28D67EBBA eif3g_human Eukaryotic translation initiation factor 3 subunit G EIF3G EIF3S4 Eukaryotic translation initiation factor 3 subunit 4 eIF-3-delta Eukaryotic translation initiation factor 3 RNA-binding subunit eIF3 p44 eIF3 p42 protein protein human Homo sapiens Human MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN DIP protein O75821 original sequence version: 87 7D7226FEDE9D6FBB eif3j_human Eukaryotic translation initiation factor 3 subunit J EIF3J PRO0391 EIF3S1 Eukaryotic translation initiation factor 3 subunit 1 eIF-3-alpha eIF3 p35 protein protein human Homo sapiens Human MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM DIP protein O75822 original sequence version: 82 DIP protein O75822 original sequence version: 130 83624235424445AA eif3c_human Eukaryotic translation initiation factor 3 subunit C EIF3C EIF3S8 Eukaryotic translation initiation factor 3 subunit 8 eIF3 p110 protein protein human Homo sapiens Human MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQSQTAY DIP protein Q99613 original sequence version: 92 DIP protein Q99613 original sequence version: 140 CE5029F4EB51C1AA eif3c_yeast Eukaryotic translation initiation factor 3 subunit C NIP1 YMR309C YM9924.01C YM9952.11C Eukaryotic translation initiation factor 3 93 kDa subunit Nuclear transport protein NIP1 Translation initiation factor eIF3, p93 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRFFSSNYEYDVASSSSEEDLLSSSEEDLLSSSSSESELDQESDDSFFNESESESEADVDSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSNYDSSDEESDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQNWGTPNIFIKVVAQVEDAVNNTQQADLKNKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDISANGFTISSSQGNDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFDASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETVLNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEITKLEEAMVKLNKEYKIAKERLNPPSNRR EE05097C44C45A4C EE05097C44C45A4C eif3h_human Eukaryotic translation initiation factor 3 subunit H EIF3S3 Eukaryotic translation initiation factor 3 subunit 3 eIF-3-gamma eIF3 p40 subunit EIF3H protein protein human Homo sapiens Human MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN DIP protein O15372 original sequence version: 74 DIP protein O15372 original sequence version: 89 DIP protein O15372 original sequence version: 118 F3A6EFA0CEF587D0 eif3d_human Eukaryotic translation initiation factor 3 subunit D EIF3D EIF3S7 Eukaryotic translation initiation factor 3 subunit 7 eIF-3-zeta eIF3 p66 protein protein human Homo sapiens Human MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSSQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEEEEEEEEET DIP protein O15371 original sequence version: 79 DIP protein O15371 original sequence version: 121 7FE0448EC3BE1711 eif3i_human Eukaryotic translation initiation factor 3 subunit I EIF3I TRIP1 EIF3S2 Eukaryotic translation initiation factor 3 subunit 2 eIF-3-beta eIF3 p36 TGF-beta receptor-interacting protein 1 protein protein human Homo sapiens Human MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA DIP protein Q13347 original sequence version: 86 02797BB72A752A96 eif3b_yeast Eukaryotic translation initiation factor 3 subunit B YOR361C PRT1 CDC63 Eukaryotic translation initiation factor 3 90 kDa subunit Translation initiation factor eIF3 p90 subunit Cell cycle regulation and translation initiation protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MKNFLPRTLKNIYELYFNNISVHSIVSRNTQLKRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLDLKHRLFLYTMKDVERYNSDDFDTEFREPDMPTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESRENWSTNYVRFSPKGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFSTEPIIVEEDNEFSPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHDATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTPETNNSACTATIAEVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNLQICRLTERDIPVEKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPETKEKTDVIKRWSLVKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKNINDNNDVSASLKDVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVKEDIIAGFKNFAWRPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQPEDASDDFTTIEEIVEEVLEETKEKVE F5E4E783408EE948 F5E4E783408EE948 eif3l_human Eukaryotic translation initiation factor 3 subunit L EIF3L HSPC021 HSPC025 EIF3S6IP Eukaryotic translation initiation factor 3 subunit 6-interacting protein MSTP005 EIF3EIP Eukaryotic translation initiation factor 3 subunit E-interacting protein protein protein human Homo sapiens Human MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP DIP protein Q9Y262 original sequence version: 62 DIP protein Q9Y262 original sequence version: 78 DIP protein Q9Y262-1 original sequence version: 109 ECBD32192D96E3FE eif3k_human Eukaryotic translation initiation factor 3 subunit K MSTP001 PTD001 HSPC029 EIF3K ARG134 EIF3S12 Eukaryotic translation initiation factor 3 subunit 12 eIF-3 p25 eIF-3 p28 Muscle-specific gene M9 protein PLAC-24 protein protein human Homo sapiens Human MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ DIP protein Q9UBQ5 original sequence version: 77 DIP protein Q9UBQ5 original sequence version: 92 DIP protein Q9UBQ5 original sequence version: 125 6B2CBBE8A9D1F28F if5_yeast Eukaryotic translation initiation factor 5 YP3085.05 YPR041W TIF5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADISHALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSCKNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSVSGSKKKKKAATASANVRGGGLSISDIAQGKSQNAPSDGTGSSTPQHHDEDEDELSRQIKAAASTLEDIEVKDDEWAVDMSEEAIRARAKELEVNSELTQLDEYGEWILEQAGEDKENLPSDVELYKKAAELDVLNDPKIGCVLAQCLFDEDIVNEIAEHNAFFTKILVTPEYEKNFMGGIERFLGLEHKDLIPLLPKILVQLYNNDIISEEEIMRFGTKSSKKFVPKEVSKKVRRAAKPFITWLETAESDDDEEDDE 1A1DA563B4ED1B1F 1A1DA563B4ED1B1F eif3a-eif3b-3 34 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 65 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 63 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3l-eif3e-1 44 72 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 73 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 56 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association eif3g-eif3i-1 35 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction yeif3a-yeif3b-1 55 74 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 59 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yeif3c-yeif3a-1 25 74 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 57 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 59 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association eif3c-eif3d-1 38 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3b-eif3g-1 18 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction eif3d-eif3e-1 26 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3a-eif3b-4 31 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 63 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3a-eif3b-5 28 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 63 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association yeif3b-yeif3a-1 6 74 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 57 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 59 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association eif3d-eif3e-2 7 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction yeif3a-yeif3b-2 5 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 59 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association eif3b-eif3g-2 2 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3h-eif3m-1 1 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction eif3m-eif3b-1 3 61 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-2 14 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3b-eif3f-1 4 60 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3f-eif3m-5 37 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction eif3h-eif3f-1 41 61 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 60 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 68 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm association association eif3b-eif3c-1 52 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3e-eif3k-1 23 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3e-eif3b-1 32 56 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3m-eif3f-3 45 61 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 60 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-3 15 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3f-eif3h-1 36 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3b-eif3e-1 24 56 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3k-eif3e-1 27 73 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 56 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3f-eif3h-2 54 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction yeif3b-yeif3g-1 53 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association eif3b-eif3k-1 50 73 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-4 42 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3b-eif3c-2 49 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 70 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 64 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 62 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association yeif3a-yeif3b-3 33 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 59 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction yeif3g-yeif3i-1 16 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction eif3h-eif3b-1 17 68 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-5 47 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 61 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3b-eif3h-1 40 68 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3k-eif3l-1 19 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction eif3f-eif3b-1 43 60 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-6 20 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3e-eif3l-1 39 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction eif3b-eif3m-1 8 61 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-7 13 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 60 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association eif3c-eif3e-1 11 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association yeif3b-yeif3g-2 9 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction eif3l-eif3b-1 51 72 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-8 12 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association yeif3b-yeif3c-1 21 58 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association eif3b-eif3l-1 46 72 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association eif3c-eif3d-9 22 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 68 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 66 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association yeif3b-yeif3c-2 48 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 67 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association eif3k-eif3b-1 10 73 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 62 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association yeif3b-yeif3i-1 29 57 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 71 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction eif3d-eif3e-3 30 72 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 73 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 56 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 69 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association