DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sun C., Yang W., Tu LC., Musser SM. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sun C., Yang W., Tu LC., Musser SM. DIP original experiment: DIP-111158X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Sun C., Yang W., Tu LC., Musser SM. Only protein-protein interactions human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sun C., Yang W., Tu LC., Musser SM. DIP original experiment: DIP-111157X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Single-molecule measurements of importin alpha/cargo complex dissociation at the nuclear pore. ima5_human Importin subunit alpha-5 KPNA1 RCH2 Karyopherin subunit alpha-1 SRP1-beta RAG cohort protein 2 Nucleoprotein interactor 1 protein protein human Homo sapiens Human MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL DIP protein P52294 original sequence version: 72 DIP protein P52294 original sequence version: 90 DIP protein P52294 original sequence version: 112 DIP protein P52294 original sequence version: 160 E8407A3352D6051C nls Nuclear localization sequence peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PPKKKRKV nup50_mouse Nuclear pore complex protein Nup50 Nup50 Npap60 Nucleoporin Nup50 50 kDa nucleoporin Nuclear pore-associated protein 60 kDa-like protein protein mouse Mus musculus Mouse MAKRVAEKELTDRNWDEEDEVEEMGTFSVASEEVMKNRAVKKAKRRNVGFESDSGGAFKGFKGLVVPSGGGGFSGFGGSGGKPLEGLTNGNSTDNATPFSNVKTAAEPKAAFGSFAVNGPTTLVDKKISSPKCNNSNQPPSSGPASSTACPGNAYHKQLAGLNCSVRDWIVKHVNTNPLCDLTPIFKDYERYLATIEKQLENGGGSSSESQTDRATAGMEPPSLFGSTKLQQESPFSFHGNKAEDTSEKVEFTAEKKSDAAQGATSASFSFGKKIESSALGSLSSGSLTGFSFSAGSSSLFGKDAAQSKAASSLFSAKASESPAGGGSSECRDGEEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKNNVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADELHKILLEKKDA DIP protein Q9JIH2 original sequence version: 61 mint Component of the nuclear pore complex that has a direct role in nuclear protein export. May serve as a binding site on the nuclear side of the pore complex for export receptor-cargo complexes. Interacts with multiple transport receptor proteins including p27Kip1. This interaction is required for correct intracellular transport and degradation of p27Kip1 Defects in Nup50 are the cause of neural tube defects, exencephaly and intrauterine growth retardation 8B9216CBB613661A kpna1-nls-1 2 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa-647-dye Alexa-647-dye alexa label alexa label c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal human Homo sapiens Human 3 unspecified role unspecified role fluorescence donor fluorescence donor Alexa-568-dye Alexa-568-dye alexa 568 label alexa 568 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human direct interaction direct interaction nup50-kpna1-4 1 5 unspecified role unspecified role fluorescence donor fluorescence donor EGFP-tag EGFP-tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa-555-dye Alexa-555-dye alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human direct interaction direct interaction