DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. DIP original experiment: DIP-111114X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. DIP original experiment: DIP-111115X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. DIP original experiment: DIP-111112X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. DIP original experiment: DIP-111111X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. Only protein-protein interactions mouse Mus musculus Mouse pull down pull down western blot western blot Immuno blot Immuno blot Smith TK., Hager HA., Francis R., Kilkenny DM., Lo CW., Bader DM. DIP original experiment: DIP-111113X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Bves directly interacts with GEFT, and controls cell shape and movement through regulation of Rac1/Cdc42 activity. rgap1_mouse Rac GTPase-activating protein 1 Mgcracgap Male germ cell RacGap Racgap1 protein protein mouse Mus musculus Mouse MDTTMVNLWTLFEQLVRRMEIINEGNESIEFIQVVKDFEDFRKKYQRTNQELEKFKDLLLKAETGRSALDVKLKHARNQVDVEIKRRQRAEAECAKLEQQIQLIRDILMCDTSGSIQLSEEQKSALAFLNRGQASSGHAGNNRLSTIDESGSILSDISFDKTDESLDWDSSLVKNFKMKKREKRRSNSRQFIDGPPGPVKKTCSIGSTVDQANESIVAKTTVTVPSDGGPIEAVSTIETLPSWTRSRGKSGPLQPVNSDSALNSRPLEPRTDTDNLGTPQNTGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRLVSHPECRDRCPLPCIPPLVGTPVKIGEGMLADFVSQASPMIPAIVVSCVNEIEQRGLTEAGLYRISGCDRTVKELKEKFLKVKTVPLLSKVDDIHVICSLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELPQANRDTLAFLMIHLQRVSQSPDTKMDIANLAKVFGPTIVAHTVPNPDPVTMFQDIKRQLKVVERLLSLPLEYWNQFMMVDQENIDSQRGNGNSTPRTPDVKVSLLGPVTTPEFQLVKTPLSSSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFFPAPYLK DIP protein Q9WVM1 original sequence version: 63 8D1B9DEC3CE057BE rhoa_mouse Transforming protein RhoA Rhoa Arha Arha2 protein protein mouse Mus musculus Mouse MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL DIP protein Q9QUI0 original sequence version: 76 DIP protein Q9QUI0 original sequence version: 77 DIP protein Q9QUI0 original sequence version: 100 C4C8BDC31FF858BC arhgp_mouse Rho guanine nucleotide exchange factor 25 Arhgef25 D10Ertd610e Geft Guanine nucleotide exchange factor GEFT Rac/Cdc42/Rho exchange factor GEFT RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT p63RhoGEF protein protein mouse Mus musculus Mouse MKPPDRPTPGRTDRILGVMGGMLRACAVPGQEGPPERDPLGPGSTKTESDCIEEDQTGQREPEVLAWAPQPESYSIAVSEGSMSASAVSGLAALSGPSSGLSSDPCSPIPPGPVTGLRRWLDHSKHCLSVETEAESGQTGQCENWTLGPTLTTGQELPELTLLTTLLEGPGDKAQPAEEETLSQAPKNEEEQKKMALERSMFVLGELVETERTYEDDLGQIVEGYMATMATQGVPESLRGRDRIVFGNIQQIYEWHRDYFLQELQQCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVLSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYRRAGKDTEELEQAVEVMCFVPKRCNDMMSLGRLRGFEGKLTAQGKLLGQDTFLVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGGRGGAQPGYVYKNSIKVSCLGLEGNLQGNPCRFALTSRGPEGGIQRYVLQASDPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPWVGSPGRMRPGDLAQASMHTPINGSLPSLLLLPRGEVSRVLLPLDTQALSDTPQTPHDSPALPTVNTPPCQARLAKLDEDEL DIP protein Q9CWR0 original sequence version: 48 popd1_mouse Blood vessel epicardial substance Bves Pop1 Popdc1 Popeye domain-containing protein 1 protein protein mouse Mus musculus Mouse MNSTESIPLAQSTVAGFTSELESLTPVPSNETTCENWREIHHLVFHVANVCFAVGLLIPTTLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSVFLGINILHLSYLLYKKRPVKIEKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQVYATEDKTSVDDRLSILLKGRMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLCTQISMLEMRNSITSSSDGEDGLHHFLRGSSSTASLPMSSPQQRASAKMKPIEEGVEDDDEVFVSPDALKVHQLP DIP protein Q9ES83 original sequence version: 51 mint B92F1942F1713027 cdc42_mouse Cell division control protein 42 homolog Cdc42 G25K GTP-binding protein protein protein mouse Mus musculus Mouse MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60766 original sequence version: 61 51A437E22A4D8FFF pak1_mouse Serine/threonine-protein kinase PAK 1 p21-activated kinase 1 p65-PAK Alpha-PAK CDC42/RAC effector kinase PAK-A Pak1 Paka protein protein mouse Mus musculus Mouse MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKREKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSKKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTPFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLQCCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLMHAAKEATKNNH DIP protein O88643 original sequence version: 78 A4861289534C3819 bves-arhgef25-1 4 9 unspecified role unspecified role bait bait binding site 118-300 binding site 118-300 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey binding site 34-450 binding site 34-450 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pak1-racgap1-1 5 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association bves-arhgef25-2 3 9 unspecified role unspecified role bait bait binding site 115-358 binding site 115-358 sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey GFP tag GFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association pak1-rhoa-1 1 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association pak1-cdc42-12 2 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 11 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association