DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. DIP original experiment: DIP-110980X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. DIP original experiment: DIP-110979X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. a7xxz0_sollc 100134911 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGSSENMDSGKVTGQKSQFSQTCNLLSQFLKKKGSVGDLNNLGIYKTTFESTGSQQTATTTTTTMNLLPMIEKSSDSSSSSSSVETNPQKPMNLFPQEFDFSKEQSTKKTESWKPDQPEKAQMTIFYGGQVIVFDDFPADKANEIMKLANKQNPTNNFTYPMIKNQKTADQSGVSFGNKLIQELPKLSMPQPSVADLPIARRNSLTRFLEKRKDRVTSIAPYQISNNKKSKNEDNKAWLGLGAQFVKTEQYF DIP protein A7XXZ0 original sequence version: 11 DIP protein A7XXZ0 original sequence version: 4 A6A19C3E33DB4984 q6tdu2_sollc Coi1 543911 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MEERNSTRLSSSTNDTVWECVIPYIQESRDRDAVSLVCKRWWQIDAITRKHITMALCYTAKPEQLSRRFPHLESVKLKGKPRAAMFNLIPEDWGGYVTPWVMEITKSFSKLKALHFRRMIVRDSDLELLANRRGRVLQVLKLDKCSGFSTDGLLHISRSCKNLRTLLMEESYIIEKDGEWAHELALNNTVLENLNFYMTDLLQVRAEDLELIARNCKSLVSMKISECEITNLLGFFRAAAALEEFGGGAFNDQPELVVENGYNEHSGKYAALVFPPRLCQLGLTYLGRNEMSILFPIASRLRKLDLLYALLDTAAHCFLLQRCPNLEILETRNVVGDRGLEVLGQYCKRLKRLRIERGADDQEMEDEEGAVTHRGLIDLAKGCLELEYMAVYVSDITNEALEVIGTYLKNLSDFRLVLLDREERITDLPLDNGVRALLRGCHNLRRFALYVRPGGLTDVGLSYVGQYSPNVRWMLLGYVGESDHGLLEFSKGCPSLQKLEVRGCCFSERALALATLQLKSLRYLWVQGYRASSAGRDLLAMARPFWNIELIPARRVIANDGNNAETVVSEHPAHILAYYSLAGQRTDFPDTVKPLDPTYLLAE DIP protein Q6TDU2 original sequence version: 17 DIP protein Q6TDU2 original sequence version: 14 4073C47F043474EC b2xvs2_sollc protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERDFMGLNIKDSLLVVKDEPVESSKDSGFRWPMSSKVGVPHFMSLNSAQDENTFKALSATDGVDAGLKRQPGELQMKQVLGGIPVTAPHSMLPSRGSVAGTTEPWFNSKGSAAPAQLTIFYGGMVNVFEDISPEKAQAIMFLAGHGCAPPNVVQPRFQLQASASKPAAADGVCVNQTPNMLPASGLSSPMSVSSHPIGQSDGSSGNKDDMKMSKTANISVTPHVKLDTSKIVTSLGPVGATTIMTAAVPQARKASLARFLEKRKERVMNLAPYGLSKKSPECSTPESNGVGFSATSTPLLAGKET a7xxz0_sollc-coi1-2 2 3 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato physical association physical association jaz3-coi1-1 1 5 unspecified role unspecified role bait bait Region 149-306 Region 149-306 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 4 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato physical association physical association