DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68684X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68678X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68679X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68676X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68683X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68680X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions mouse Mus musculus Mouse molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-254146X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68682X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Wang J., Levasseur DN., Orkin SH. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang J., Levasseur DN., Orkin SH. DIP original experiment: DIP-68681X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Requirement of Nanog dimerization for stem cell self-renewal and pluripotency. zmym2_mouse Zinc finger MYM-type protein 2 Zmym2 Zfp198 Znf198 Zinc finger protein 198 protein protein mouse Mus musculus Mouse MDTSSVGTLELTDQTPVLLGSTAMATSLTNVGNSFSGPPNPLVSRSSKFQNSSVEDDDDVVFIEPVQPPPSSAPLVADQRPITFTSSKNEELQGNDPKILPSSKELAPQKGSVSETIVIDDEEDMETNQGQEKSSSNFIERRPSETKNRTNDVDFSSSTFSRSKVNAGVSNSGITTEPDSEIQIANVTTLETGVSSVSDGQLESTDGRDMNLMITHVTSLHNTSLGDGSNGLQSSNFGVNIQTYTPSLTSQTKAGVGPFNPGRMNVAGDVFQNGESAPHHNPDSWISQSASFPRNQKQQGVDSLSPVASLPKQIFQPSNQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQSPAKGALNKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVVDGQQKRFCCQSCVTEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQEWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTPNKEMKNKAILCKPLTMTKATYCKPHMQTKSCQTDENWKTEYVPVPIPVPVYVPVPMHMYSQNIPVPTTVPVPVPVPVFLPAPLDSSEKIPATVEDLKSKVSSDPLDSELLTMTDMMTEEEGKAEASNINSVIIETDIIGSDLTKNSDPDIQSNMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSKKKGTKRKAVSGYQSHDDSSDNSECSFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDSIYYLCLGIQEYLCGSNRKDNIFIDPGYQMFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKIATGKRKHEDDEPVFEQVENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD DIP protein Q9CU65 original sequence version: 49 1D4955422F0646B4 nanog_mouse Homeobox protein NANOG Nanog Ecat4 Enk Homeobox transcription factor Nanog Early embryo specific expression NK-type homeobox protein ES cell-associated protein 4 protein protein mouse Mus musculus Mouse MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI DIP protein Q80Z64 original sequence version: 43 DIP protein Q80Z64 original sequence version: 64 DIP protein Q80Z64 original sequence version: 77 DIP protein Q80Z64 original sequence version: 78 4EF96408B767C79F sall4_mouse Sal-like protein 4 Sall4 Zinc finger protein SALL4 protein protein mouse Mus musculus Mouse MSRRKQAKPQHINWEEGQGEQPQQLPSPDLAEALAAEEPGAPVNSPGNCDEASEDSIPVKRPRREDTHICNKCCAEFFSLSEFMEHKKSCTKTPPVLIMNDSEGPVPSEDFSRAALSHQLGSPSNKDSLQENGSSSGDLKKLGTDSILYLKTEATQPSTPQDISYLPKGKVANTNVTLQALRGTKVAVNQRGAEAPMAPMPAAQGIPWVLEQILCLQQQQLQQIQLTEQIRVQVNMWAAHALHSGVAGADTLKALSSHVSQQVSVSQQVSAAVALLSQKASNPALSLDALKQAKLPHASVPSAASPLSSGLTSFTLKPDGTRVLPNFVSRLPSALLPQTPGSVLLQSPFSAVTLDQSKKGKGKPQNLSASASVLDVKAKDEVVLGKHKCRYCPKVFGTDSSLQIHLRSHTGERPYVCPICGHRFTTKGNLKVHLQRHPEVKANPQLLAEFQDKGAVSAASHYALPVPVPADESSLSVDAEPVPVTGTPSLGLPQKLTSGPNSRDLMGGSLPNDMQPGPSPESEAGLPLLGVGMIHNPPKAGGFQGTGAPESGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTTVKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPESPCDFTAPEPVAVSENGSASGVCQDDAAEGMEAEEVCSQDVPSGPSTVSLPVPSAHLASPSLGFSVLASLDTQGKGALPALALQRQSSRENSSLEGGDTGPANDSSLLVGDQECQSRSPDATETMCYQAVSPANSQAGSVKSRSPEGHKAEGVESCRVDTEGRTSLPPTFIRAQPTFVKVEVPGTFVGPPSMPSGMPPLLASQPQPRRQAKQHCCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENPMAALSAEGKRAPEVFSKELLSPAVSVDPASWNQYTSVLNGGLAMKTNEISVIQSGGIPTLPVSLGASSVVSNGTISKLDGSQTGVSMPMSGNGEKLAVPDGMAKHQFPHFLEENKIAVS DIP protein Q8BX22 original sequence version: 49 DIP protein Q8BX22 original sequence version: 66 DIP protein Q8BX22 original sequence version: 55 23B92F488AAF53E5 po5f1_mouse POU domain, class 5, transcription factor 1 Pou5f1 Oct-3 Oct-4 Otf-3 Otf3 Octamer-binding transcription factor 3 NF-A3 Octamer-binding protein 3 Octamer-binding protein 4 protein protein mouse Mus musculus Mouse MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPPAYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN DIP protein P20263 original sequence version: 87 DIP protein P20263 original sequence version: 121 DIP protein P20263 original sequence version: 118 DIP protein P20263 original sequence version: 137 DIP protein P20263 original sequence version: 107 757E41DF52286714 nr0b1_mouse Nuclear receptor subfamily 0 group B member 1 Nr0b1 Ahch Dax1 Nuclear receptor DAX-1 protein protein mouse Mus musculus Mouse MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAKL DIP protein Q61066 original sequence version: 72 DE1FB01C30F883CF nacc1_mouse Nucleus accumbens-associated protein 1 Nacc1 Btbd14b Nac1 BTB/POZ domain-containing protein 14B protein protein mouse Mus musculus Mouse MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNSSRSAVVELPAAVQPQSFQQILTFCYTGRLSMNMGDQFLLIYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHPEEAPSSEPQSPVAQTLGWPACSTPLPLVSRVKTEQELDSVQCTPMAKRLWDSSQKEAGGSGGNNGSRKMAKFSTPDLALNRMPQPLSMATATAAVAVVAVGGCVSGPSMSERTSPGTSSAYTSDSPSSYHNEEDEEEDAGEEGTDEQYRQICNMYTMYSMLNVGQTAEKVEALPEQVVLESRSRIRVRQDLASLPAELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWLPKTKPLHLVEGDNYSSFISDTCKIEPDMMSMEHSFETASHDGEAGPSAEVLQ DIP protein Q7TSZ8 original sequence version: 31 C83C23891B097626 zn281_mouse Zinc finger protein 281 Znf281 Zfp281 protein protein mouse Mus musculus Mouse MKIGSGFLSGGGGPSSSGGSGSGGSSGSASGGSGGGRRAEMEPTFPQSMVMFNHRLPPVTSFTRPAGTAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPADPEEQPSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSLLHQHAQQQPAQHHRDVLLSSGSRTDEHGNQEPKQDANVKKAKRPKPESQGIKAKRKPSASSKPLVGEGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTCGEAIAKGAASAEPGSSNHNSMGNLAVLSQGNTSSSRRKSKSKSIAIENKEHKTGKTNESQMSNNINMQSYSVEMPTVSTSGSIIGTGIDELQKRVPKLIFKKGSRKNADKSYLNFVSPLPDVVGQKSLSGKPGGSLGIVSNNSVETISLLQSTSGKQGPISSNYDDAMQFSKKRRYLPTASSNSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSGKSETQKEDPFNLTEPRVDLHTSGEHSELVQEENLSPGTQTPSNDKTSMLQEYSKYLQQAFEKSTNAGFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQQKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR DIP protein Q99LI5 original sequence version: 62 7F4EBA44C2CC2AF2 q80z64-1 Homeobox protein NANOG Nanog Ecat4 Enk ES cell-associated protein 4 Early embryo specific expression NK-type homeobox protein Homeobox transcription factor Nanog protein protein mouse Mus musculus Mouse MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI DIP protein Q80Z64-1 original sequence version: 43 DIP protein Q80Z64-1 original sequence version: 77 sall4-nanog-1 4 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 12 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association nanog-nanog-1 3 17 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 156-305 Region 156-305 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association zmym2-nanog-1 9 10 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association nacc1-nanog-1 5 15 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association nr0b1-nanog-1 8 14 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association nanog-nanog-2 2 17 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association pou5f1-nanog-1 1 13 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association znf281-nanog-1 6 16 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 17 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association nanog-2 7 11 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse physical association physical association 1 nodeMerge04 2013-09-28