DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. DIP original experiment: DIP-68641X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. DIP original experiment: DIP-68639X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kalyuzhniy O., Di Paolo NC., Silvestry M., Hofherr SE., Barry MA., Stewart PL., Shayakhmetov DM. DIP original experiment: DIP-68640X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Adenovirus serotype 5 hexon is critical for virus infection of hepatocytes in vivo. cap9_ade02 Hexon-interlacing protein IX Protein IX protein protein ade02 Human adenovirus C serotype 2 (HAdV-2) Human adenovirus 2 HAdV-2 MSANSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLDLRQQVSALKASSPPNAV DIP protein P03282 original sequence version: 32 fa10_human Coagulation factor X Stuart factor Stuart-Prower factor F10 protein protein human Homo sapiens Human MGRPLHLVLLSASLAGLLLLGESLFIRREQANNILARVTRANSFLEEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK DIP protein P00742 original sequence version: 131 F81D5746AF4797AF cap9_ade05 Hexon-interlacing protein IX Protein IX protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVSGTPLETAASAAASAAAATARGIVTDFAFLSPLASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLDLRQQVSALKASSPPNAV DIP protein P03281 original sequence version: 34 DAFD4045CAB616FB cap9_ade05-1 2 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction cap9_ade02-1 3 4 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction cap9_ade05-f10-1 1 5 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 6 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association