DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113651X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113649X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113654X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113653X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113655X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113652X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. Nature structural & molecular biology 2008 imex curation Veltel S., Gasper R., Eisenacher E., Wittinghofer A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Veltel S., Gasper R., Eisenacher E., Wittinghofer A. DIP original experiment: DIP-113650X Nature structural & molecular biology 2008 IMEx The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3. arl3_mouse ADP-ribosylation factor-like protein 3 Arl3 protein protein mouse Mus musculus Mouse MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK DIP protein Q9WUL7 original sequence version: 52 DIP protein Q9WUL7 original sequence version: 69 DIP protein Q9WUL7 original sequence version: 139 16B85B2268ADB9DE cin4_yeast GTP-binding protein CIN4 CIN4 GTP1 UGX1 YMR138W YM9375.07 Chromosome instability protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLLSIIRKQKLRDKEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVIVVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLRDRLVESCHFTQ CF30AF932A2D2566 CF30AF932A2D2566 arl2_mouse ADP-ribosylation factor-like protein 2 Arl2 protein protein mouse Mus musculus Mouse MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD DIP protein Q9D0J4 original sequence version: 62 DIP protein Q9D0J4 original sequence version: 126 8B3741700BFED3F8 tbcc_human Tubulin-specific chaperone C TBCC Tubulin-folding cofactor C protein protein human Homo sapiens Human MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAAVEELLERAESVERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASELHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD DIP protein Q15814 original sequence version: 64 tbcc_yeast Tubulin-specific chaperone C CIN2 YPL241C P1043 Tubulin-folding cofactor C Chromosome instability protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDFTAKIKELERELSETSDYKTLQKKTISLRSELNTLSHSLTSYEKEHFSNDIENVLKSINAKLSESKGKKRLFSFKQKNSSSAVHKNVERTELANAPAYTTTLKKHYVLEKGDSAFENLEFCTVTSTTDYSGNSALSGSLCFRNITKCVINLQRIFFQTGSIFITDCTDSIIFLRSPSDKDFQIRLRDLKNCKILIEKLSPSIDCKQVVIIENCHKCIFNASTRDHLIIQDFSNPFQSEETEDNSAFAFEDFDICNKDTMQLFRAYL CE9F2DB6B76997A8 CE9F2DB6B76997A8 xrp2_human Protein XRP2 RP2 protein protein human Homo sapiens Human MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI DIP protein O75695 original sequence version: 47 DIP protein O75695 original sequence version: 73 mint Stimulates the GTPase activity of tubulin, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor for ARL3 Defects in RP2 are the cause of retinitis pigmentosa type 2 (RP2) [MIM:312600]; also known as X-linked retinitis pigmentosa 2 (XLRP-2). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well 3C912B52C53A817E arl3-rp2-4 2 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 17-177 Region 17-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction arl2-rp2-1 5 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction arl3-tbcc-1 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction arl3-rp2-5 3 13 unspecified role unspecified role unspecified role unspecified role O75695:p.Arg118Ala R118A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R118A'. Wed May 02 14:39:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg118ala' Tue Jun 30 18:11:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg118Ala' O75695:p.Phe177Ala F177A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F177A'. Wed May 02 18:28:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe177ala' Tue Jun 30 19:13:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe177Ala' O75695:p.Gln116Ala Q116A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q116A'. Wed May 02 18:09:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln116ala' Tue Jun 30 19:02:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln116Ala' O75695:p.Glu138Gly E138G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E138G'. Wed May 02 17:21:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu138gly' Tue Jun 30 16:12:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu138Gly' ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Q9WUL7:p.Gln71Leu Q71L mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q71L'. Wed May 02 15:14:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71leu' Tue Jun 30 15:49:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' ecolx Escherichia coli direct interaction direct interaction arl3-rp2-6 7 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 17-177 Region 17-177 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cin2-cin4-1 6 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction arl3-rp2-7 1 13 unspecified role unspecified role unspecified role unspecified role O75695:p.Arg118His R118H mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R H This feature has been corrected as a result of our quality control procedures. The original label was 'R118H'. Wed May 02 20:13:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg118his' Tue Jun 30 18:36:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg118His' O75695:p.Glu138Gly E138G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E G This feature has been corrected as a result of our quality control procedures. The original label was 'E138G'. Wed May 02 19:46:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu138gly' Tue Jun 30 17:28:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu138Gly' O75695:p.Gln115Ala Q115A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q115A'. Wed May 02 17:56:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln115ala' Tue Jun 30 15:42:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln115Ala' O75695:p.Gln116Ala Q116A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q116A'. Wed May 02 17:02:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln116ala' Tue Jun 30 17:33:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln116Ala' O75695:p.[Arg120His;Asp121Ser] R120H/D121S mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S certain certain sequence position certain certain certain sequence position certain R H This feature has been corrected as a result of our quality control procedures. The original label was 'R120H/D121S'. Wed May 02 16:10:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg120his,asp121ser' Tue Jun 30 20:11:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg120His;Asp121Ser]' O75695:p.[Ser28Ala;Trp29Ala] S28A/W29A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S28A/W29A'. Wed May 02 17:24:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser28ala,trp29ala' Tue Jun 30 16:26:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser28Ala;Trp29Ala]' Region 2-30 Region 2-30 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Q9WUL7:p.Arg72Ala R72A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R72A'. Wed May 02 18:51:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg72ala' Tue Jun 30 18:25:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg72Ala' Q9WUL7:p.[Glu164Ala;Asp168Ala] E164A/D168A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E164A/D168A'. Wed May 02 16:35:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu164ala,asp168ala' Tue Jun 30 20:05:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu164Ala;Asp168Ala]' ecolx Escherichia coli direct interaction direct interaction