DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Nature structural & molecular biology 2008 imex curation Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. DIP original experiment: DIP-113647X Nature structural & molecular biology 2008 IMEx Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. Nature structural & molecular biology 2008 imex curation Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huai Q., Zhou A., Lin L., Mazar AP., Parry GC., Callahan J., Shaw DE., Furie B., Furie BC., Huang M. DIP original experiment: DIP-113648X Nature structural & molecular biology 2008 IMEx Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes. urok_human Urokinase-type plasminogen activator PLAU protein protein human Homo sapiens Human MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL DIP protein P00749 original sequence version: 130 62C72400BC23115F vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL DIP protein P04004 original sequence version: 115 0D6DB5591CBFEF45 q03405-1 Urokinase plasminogen activator surface receptor Monocyte activation antigen Mo3 PLAUR MO3 UPAR uPAR1 GPI-anchored protein protein human Homo sapiens Human MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT DIP protein Q03405-1 original sequence version: 100 plau-plaur-2 1 5 unspecified role unspecified role unspecified role unspecified role Region 1-277 Region 1-277 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 3 unspecified role unspecified role unspecified role unspecified role Region 1-143 Region 1-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction plau-plaur-3 2 4 unspecified role unspecified role unspecified role unspecified role Region 1-50 Region 1-50 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role Region 1-277 Region 1-277 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly 3 unspecified role unspecified role unspecified role unspecified role Region 1-143 Region 1-143 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction