DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Phosphorylation-independent regulation of the diguanylate cyclase WspR. Phosphorylation-independent regulation of the diguanylate cyclase WspR. PLoS biology 2008 imex curation De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. DIP original experiment: DIP-68377X PLoS biology 2008 IMEx Phosphorylation-independent regulation of the diguanylate cyclase WspR. Phosphorylation-independent regulation of the diguanylate cyclase WspR. Phosphorylation-independent regulation of the diguanylate cyclase WspR. PLoS biology 2008 imex curation De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. DIP original experiment: DIP-68379X PLoS biology 2008 IMEx Phosphorylation-independent regulation of the diguanylate cyclase WspR. Phosphorylation-independent regulation of the diguanylate cyclase WspR. Phosphorylation-independent regulation of the diguanylate cyclase WspR. PLoS biology 2008 imex curation De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined De N., Pirruccello M., Krasteva PV., Bae N., Raghavan RV., Sondermann H. DIP original experiment: DIP-68378X PLoS biology 2008 IMEx Phosphorylation-independent regulation of the diguanylate cyclase WspR. q9hxt9_pseae wspR PA3702 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MHNPHESKTDLGAPLDGAVMVLLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSRSYIALQQRDEAYRALRESQQQLLETNLVLQRLMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLMEQPVPPAPAG AE706D630586649E wspr-1 1 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction wspr-2 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction wspr-3 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction