DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. DIP original experiment: DIP-68586X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. DIP original experiment: DIP-68585X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. DIP original experiment: DIP-68587X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tamayo AG., Bharti A., Trujillo C., Harrison R., Murphy JR. DIP original experiment: DIP-68584X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COPI coatomer complex proteins facilitate the translocation of anthrax lethal factor across vesicular membranes in vitro. lef_bacan Lethal factor Anthrax lethal toxin endopeptidase component lef pXO1-107 BXA0172 GBAA_pXO1_0172 protein protein bacan Bacillus anthracis MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEERNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGDITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNVYYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLARYEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSSDFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNINQEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNGRFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS DIP protein P15917 original sequence version: 109 DIP protein P15917 original sequence version: 138 DIP protein P15917 original sequence version: 93 DIP protein P15917 original sequence version: 98 DIP protein P15917 original sequence version: 112 DIP protein P15917 original sequence version: 125 2076B4D7277317EE copz1_human Coatomer subunit zeta-1 Zeta-1-coat protein COPZ1 COPZ CGI-120 HSPC181 protein protein human Homo sapiens Human MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR DIP protein P61923 original sequence version: 41 355530D032D3A049 copb_human Coatomer subunit beta COPB1 COPB MSTP026 Beta-coat protein protein protein human Homo sapiens Human MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVLKKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIRRSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRPPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSLPKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEKRNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLTGFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI DIP protein P53618 original sequence version: 63 DIP protein P53618 original sequence version: 90 DIP protein P53618 original sequence version: 115 BE916C1C5A599D79 copg1_human Coatomer subunit gamma-1 COPG1 COPG Gamma-1-coat protein protein protein human Homo sapiens Human MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNEAQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKVTRHGLKSPFAYCMMIRVASKQLEEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRVVLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVKQPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSLEELPVDIILASVG DIP protein Q9Y678 original sequence version: 56 DIP protein Q9Y678 original sequence version: 103 A2FAB492C598EC98 copb1-copg1-1 1 6 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human association association lef-copb1-1 4 7 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait Region 1-254 Region 1-254 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association copg1-copb1-1 3 6 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human association association lef-copz1-1 2 6 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait Region 1-254 Region 1-254 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association