DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68534X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68523X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68532X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68529X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68533X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68531X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68525X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68524X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68530X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68526X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68528X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Chen G., Guo X., Lv F., Xu Y., Gao G. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen G., Guo X., Lv F., Xu Y., Gao G. DIP original experiment: DIP-68527X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx p72 DEAD box RNA helicase is required for optimal function of the zinc-finger antiviral protein. zcchv_rat Zinc finger CCCH-type antiviral protein 1 Zc3hav1 Zap ADP-ribosyltransferase diphtheria toxin-like 13 Zinc finger antiviral protein Inactive Poly [ADP-ribose] polymerase 13 protein protein rat Rattus norvegicus (Rat) Rat MADPGVCCFITKILCAHGGRMTLEELLGEIRLPEAQLYELLETAGPDRFVLLETGGQAGITRSVVATTRARVCRRKYCQRPCDSLHLCKLNLLGRCHYAQSQRNLCKYSHDVLSEQNFQILKNHELSGLNQEELACLLVQSDPFFLPEICKSYKGEGRKQTCGQPQPCERLHICEHFTRGNCSYLNCLRSHNLMDRKVLTIMREHGLSPDVVQNIQDICNNKHARRNPPGTRAAHPHRRGGAHRDRSKSRDRFLHNSLEFLSPVVSPLGSGPPSPDVTSCKDSLEDVSVDVTQKFKYLGTHDRAQLSPVSSKAAGVQGPSQMRASQEFSEDGNLDDIFSRNRSDSSSSRASAAKVAQRNEAVAMKMGMEVKGKKEAPDIDRVPFLNSYIDGVTMEKASVSGIPGKKFTANDLENLLLLNDTWKNVAKPQDLQTTGRITDSGQDKAFLQNKYGGNPVWASASTHNAPNGSSQIMDETPNVSKSSTSGFAIKPAIAGGKEAVYSGVQSPRSQVLAVPGEATTPVQSNRLPQSPLSSSSHRAAASGSPGKNSTHTSVSPAIESSRMTSDPDEYLLRYILNPLFRMDNHGPKEICQDHLYKGCQQSHCDRSHFHLPYRWQMFVYTTWRDFQDMESIEQAYCDPHVELILIENHQINFQKMTCDSYPIRRLSTPSYEEKPLSAVFATKWIWYWKNEFNEYIQYGNESPGHTSSDINSAYLESFFQSCPRGVLPFQAGSQKYELSFQGMIQTNIASKTQRHVVRRPVFVSSNDVEQKRRGPE DIP protein Q8K3Y6 original sequence version: 71 DIP protein Q8K3Y6 original sequence version: 31 DIP protein Q8K3Y6 original sequence version: 61 DIP protein Q8K3Y6 original sequence version: 57 D13F61A9F8E5B552 exos5_human Exosome complex component RRP46 EXOSC5 CML28 RRP46 Ribosomal RNA-processing protein 46 Exosome component 5 p12B Chronic myelogenous leukemia tumor antigen 28 protein protein human Homo sapiens Human MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS DIP protein Q9NQT4 original sequence version: 123 DIP protein Q9NQT4 original sequence version: 66 DIP protein Q9NQT4 original sequence version: 112 DIP protein Q9NQT4 original sequence version: 129 DIP protein Q9NQT4 original sequence version: 105 C3C1FCB39D85B1EE ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ DIP protein P17844 original sequence version: 98 DIP protein P17844 original sequence version: 148 DIP protein P17844 original sequence version: 137 DIP protein P17844 original sequence version: 124 DIP protein P17844 original sequence version: 177 DIP protein P17844-1 original sequence version: 177 DIP protein P17844 original sequence version: 179 DIP protein P17844 original sequence version: 182 84DF684FD6871594 ddx17_human Probable ATP-dependent RNA helicase DDX17 DEAD box protein 17 RNA-dependent helicase p72 DEAD box protein p72 DDX17 DEAD box protein p82 protein protein human Homo sapiens Human MPTGFVAPILCVLLPSPTREAATVASATGDSASERESAAPAAAPTAEAPPPSVVTRPEPQALPSPAIRAPLPDLYPFGTMRGGGFGDRDRDRDRGGFGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK DIP protein Q92841 original sequence version: 89 DIP protein Q92841 original sequence version: 125 DIP protein Q92841 original sequence version: 112 DIP protein Q92841 original sequence version: 134 DIP protein Q92841 original sequence version: 145 DIP protein Q92841 original sequence version: 129 C819F53515B1BC39 ttp_human mRNA decay activator protein ZFP36 ZFP36 G0S24 TIS11A TTP Growth factor-inducible nuclear protein NUP475 G0/G1 switch regulatory protein 24 NUP475 Tristetraprolin Zinc finger protein 36 RNF162A protein protein human Homo sapiens Human MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE DIP protein P26651 original sequence version: 79 DIP protein P26651 original sequence version: 127 DDD9AD950AF7AF98 exos3_human Exosome complex component RRP40 EXOSC3 RRP40 CGI-102 Ribosomal RNA-processing protein 40 Exosome component 3 p10 protein protein human Homo sapiens Human MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES DIP protein Q9NQT5 original sequence version: 130 DIP protein Q9NQT5 original sequence version: 72 DIP protein Q9NQT5 original sequence version: 117 DIP protein Q9NQT5 original sequence version: 136 264322144A199166 zc3hav1-ddx17-1 2 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx17-zc3hav1-1 7 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx17-zfp36-1 12 17 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx17-zc3hav1-2 4 16 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Binding region 1-254 Binding region 1-254 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association exosc5-ddx17-1 5 14 unspecified role unspecified role bait bait human Homo sapiens Human 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association exosc3-ddx17-1 6 18 unspecified role unspecified role bait bait human Homo sapiens Human 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association zc3hav1-ddx17-2 8 16 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx5-zc3hav1-1 10 15 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association ddx17-zc3hav1-3 11 16 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli direct interaction direct interaction exosc3-ddx17-2 9 18 unspecified role unspecified role bait bait human Homo sapiens Human 16 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association exosc5-zc3hav1-4 1 14 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association exosc3-zc3hav1-1 3 18 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human physical association physical association