DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68184X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68186X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68182X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68181X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68187X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68183X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. PLoS biology 2008 imex curation Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang M., Li B., Liu CJ., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. DIP original experiment: DIP-68185X PLoS biology 2008 IMEx Insights into mad2 regulation in the spindle checkpoint revealed by the crystal structure of the symmetric mad2 dimer. cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR DIP protein Q12834 original sequence version: 132 DIP protein Q12834 original sequence version: 74 DIP protein Q12834 original sequence version: 100 DIP protein Q12834 original sequence version: 118 DIP protein Q12834 original sequence version: 125 DIP protein Q12834 original sequence version: 114 DIP protein Q12834 original sequence version: 147 DIP protein Q12834 original sequence version: 162 FD5C967AF84089E8 md1l1_human Mitotic spindle assembly checkpoint protein MAD1 Mitotic arrest deficient 1-like protein 1 Mitotic checkpoint MAD1 protein homolog Tax-binding protein 181 MAD1L1 MAD1 TXBP181 protein protein human Homo sapiens Human MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQSFLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA DIP protein Q9Y6D9 original sequence version: 56 DIP protein Q9Y6D9 original sequence version: 99 DIP protein Q9Y6D9-1 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 135 DIP protein Q9Y6D9 original sequence version: 113 DA65529856A37EE3 md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND DIP protein Q13257 original sequence version: 133 DIP protein Q13257 original sequence version: 78 DIP protein Q13257 original sequence version: 105 DIP protein Q13257 original sequence version: 120 DIP protein Q13257 original sequence version: 127 DIP protein Q13257 original sequence version: 116 DIP protein Q13257 original sequence version: 150 DIP protein Q13257 original sequence version: 156 DIP protein Q13257 original sequence version: 134 B8DCBF0043836764 mad1l1-mad2l1-1 2 10 unspecified role unspecified role unspecified role unspecified role Region 495-718 Region 495-718 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cdc20-mad2l1-9 4 8 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 10 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Arg133Ala;Trp167Ala] R133A/W167A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/W167A'. Wed May 02 17:18:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,trp167ala' Tue Jun 30 18:04:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;Trp167Ala]' Q13257:p.[Trp75Ala;Arg133Ala] R133A/W75A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/W75A'. Wed May 02 14:37:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp75ala,arg133ala' Tue Jun 30 18:54:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp75Ala;Arg133Ala]' Q13257:p.[Arg133Ala;Phe186Ala] R133A/F186A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/F186A'. Wed May 02 16:55:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,phe186ala' Tue Jun 30 17:05:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;Phe186Ala]' Q13257:p.[Arg133Ala;Thr188Ala] R133A/T188A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/T188A'. Wed May 02 16:08:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,thr188ala' Tue Jun 30 16:25:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;Thr188Ala]' Q13257:p.[Arg133Ala;His191Ala] R133A/H191A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/H191A'. Wed May 02 19:45:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,his191ala' Tue Jun 30 19:45:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;His191Ala]' Q13257:p.[Arg133Ala;Val197Ala] R133A/V197A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/V197A'. Wed May 02 17:39:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,val197ala' Tue Jun 30 20:22:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;Val197Ala]' Q13257:p.[Arg133Ala;Tyr199Ala] R133A/Y199A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R133A/Y199A'. Wed May 02 17:26:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg133ala,tyr199ala' Tue Jun 30 18:24:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg133Ala;Tyr199Ala]' ecolx Escherichia coli direct interaction direct interaction mad2l1-1 6 10 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'L13A/C79S/C106S'. Wed May 02 16:36:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13ala,cys79ser,cys106ser' Tue Jun 30 16:11:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu13Ala;Cys79Ser;Cys106Ser]' ecolx Escherichia coli direct interaction direct interaction mad2l1-2 1 10 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'L13A/C79S/C106S'. Wed May 02 14:26:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13ala,cys79ser,cys106ser' Tue Jun 30 16:46:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu13Ala;Cys79Ser;Cys106Ser]' ecolx Escherichia coli direct interaction direct interaction mad1l1-mad2l1-7 5 10 unspecified role unspecified role unspecified role unspecified role Region 495-718 Region 495-718 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mad2l1-3 7 10 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'L13A/C79S/C106S'. Wed May 02 19:03:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13ala,cys79ser,cys106ser' Tue Jun 30 18:50:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu13Ala;Cys79Ser;Cys106Ser]' ecolx Escherichia coli direct interaction direct interaction mad2l1-4 3 10 unspecified role unspecified role unspecified role unspecified role Q13257:p.[Leu13Ala;Cys79Ser;Cys106Ser] L13A/C79S/C106S mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'L13A/C79S/C106S'. Wed May 02 18:11:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu13ala,cys79ser,cys106ser' Tue Jun 30 16:20:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu13Ala;Cys79Ser;Cys106Ser]' ecolx Escherichia coli direct interaction direct interaction