DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68494X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68495X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68491X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68492X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68497X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68498X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68496X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. A SPIKE1 signaling complex controls actin-dependent cell morphogenesis through the heteromeric WAVE and ARP2/3 complexes. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Basu D., Le J., Zakharova T., Mallery EL., Szymanski DB. DIP original experiment: DIP-68493X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx f.4 rac5_arath Rac-like GTP-binding protein ARAC5 ARAC5 ATGP3 ROP4 T4O12.8 At1g75840 GTPase protein ROP4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCVFL DIP protein Q38937 original sequence version: 77 631317F3DA441A35 nckp1_arath Protein NAP1 Nck-associated protein 1 p125Nap1 NAP of plants ARP2/3 regulatory protein subunit NAPP Protein GNARLED NAP1 GRL NAP NAPP T4C15.22 At2g35110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANSRQYYPSQDESMSPTSVRSREWEGPSRWTEYLGPEMAASVSSTRSSKQIDGHVGGSTKALNIQWVVQMIEVADGLMAKMYRLNQILEYPDPVGHVFSEAFWKAGVFPNHPRICTLLSKKFPEHFSKLQLERIDKFSLDSLHDGAELHLQSLEPWIQLLLDLMAFREQALRLILDLSSTVITLLPHQNSLILHAFMDLFCAFVRVNLFAEKIPRKMLLQVYNLLHALSRNDRDCDFYHRLVQFIDSYDPPLKGLQEDLNFVSPRIGEVLEAVGPSIFLSADTRKLRNEGFLSPYHPRFPDILTNSAHPMRAQDLANVTSYREWVLLGYLVCPDELLRVTSIDIALVVLKENLVVTLFRDEVSLYQMVCEKEFGIGISFASADSINLTMQYILLHEDYQLYVLPRVLESKKMAKSGRTKQKEADLEYSVAKQVEKMISEVHEQALQLCDTIHRERRILLKQEIGRMVLFFTDQPSLLAPNIQMVFSALALAQSEVLWYFQHAGIASSRSKAARVIPVDIDPNDPTIGFLLDGMDRLCCLVRKYISAARGYALSYLSSSAGRIRYLMGTPGIVALDLDPTLKGLFQRIVQHLESIPKAQGENVSAITCDLSDFRKDWLSILMIVTSSRSSINIRHLEKATVSTGKEGLLSEGNAAYNWSRCVDELESQLSKHGSLKKLYFYHQHLTTVFRNTMFGPEGRPQHCCAWLSVASSFPECASLIIPEEVTKFGRDAVLYVESLIESIMGGLEGLINILDSEGGFGALESQLLPEQAAAYLNNASRISAPSVKSPRVVGGFTLPGHESYPENNKSIKMLEAAIQRLTNLCSILNDMEPICVINHVFVLREYMRECILGNFKRRFLTALQTDNDLQRPSVLESLIRRHMGIVHLAEQHVSMDLTQGIREILLTEAFSGPVSSLHTFEKPAEQQQTTGSAVEVVCNWYMDNIIKDVSGAGILFAPRHKYFKSTRPVGGYFAESVTDLKELQAFVRIFGGYGVDRLDRMMKVHTAALVNCIETSLRSNRELIEAAAASMHSGDRVERDASVRQIVDLDTVIGFCIEAGQALAFDDLLAEASGAVLEDNASLIHSMISGIVEHIPEEIPEKKEIRRIKGVANGVGVAGDHDSEWVRLILEEVGGANDNSWSLLPYFFASFMTSNAWNTTGFNIETGGFSNNIHCLARCISAVIAGSEYVRLQREYQQQHQSLSNGHHSSENLDSEFPPRVTAEASIKSSMLLFVKFAASIVLDSWSEANRSHLVAKLIFLDQLCEISPYLPRSSLESHVPYTILRSIYTQYYSNTPSTPLSTASPYHSPSVSLIHASPSMKNSTTPQRGSGSGSSSTAAPDSGYFKGSSSSLYGQEHYTESETGNSRNNENNNNNKQRGSSRRSGPLDYSSSHKGGSGSNSTGPSPLPRFAVSRSGPISYKQHN DIP protein Q5S2C4 original sequence version: 24 A2008CEC598BB6F1 rac6_arath Rac-like GTP-binding protein ARAC6 T19K4.80 ARAC6 RAC2 ROP5 F4B14_220 At4g35950 GTPase protein ROP5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQPPKQKKKKNKAQKACSIL DIP protein Q9SBJ6 original sequence version: 53 D26BE6D3827C1632 pir_arath Protein PIR PIR of plants Protein PIROGI Protein KLUNKER PIR KLK PIRP F20L16.130 At5g18410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVPVEEAIAALSTFSLEDEQPEVQGPAVMVSAERAATDSPIEYSDVAAYRLSLSEDTKALNQLNTLIQEGKEMASILYTYRSCVKALPQLPESMKHSQADLYLETYQVLDLEMSRLREIQRWQSSASAKLAADMQRFSRPERRINGPTVTHLWSMLKLLDVLVQLDHLKNAKASIPNDFSWYKRTFTQVSAQWQDTDTMREELDDLQIFLSTRWAILLNLHVEMFRVNNVEDILQVLIVFIVESLELDFALLFPERYILLRVLPVLVVLATPSEKDTEALYKRVKLNRLINIFKNDPVIPAFPDLHLSPAAILKELSVYFQKFSSQTRLLTLPAPHELPPREALEYQRHYLIVNHIGALRAEHDDFTIRFASSMNQLLLLKSNDGAYTEWCREVKGNMYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSDYEKVVRFNYTAEERKALVELVGYIKSVGSMLQRCDTLVADALWETIHAEVQDFVQNTLATMLRTTFRKKKDLSRILSDMRTLSADWMANTRPEHEMPSSQHGNDESRGNFFYPRPVAPTAAQVHCLQFLIYEVVSGGNLRRPGGFFGNNGSEIPVNDLKQLETFFYKLSFFLHILDYSASIGILTDLGFLWFREFYLESSRVIQFPIECSLPWMLIDYILEAQNSGLLESVLLPFDIYNDSAQQALVVLRQRFLYDEIEAEVDHGFDIFVSRLSESIFTYYKSWSASELLDPSFLFALDNGEKFSIQPVRFTALFKMTKVKILGRTINLRSLIAQRMNRIFRENLEFLFDRFESQDLCAVVELEKLIDILKHSHELLSQDLSIDPFSLMLNEMQENISLVSFSSRLATQIWSEMQSDFLPNFILCNTTQRFVRSSKVPPTQKPSVPSAKPSFYCGTQDLNAAHQSFARLHSGFFGIPHLFSIVKLLGSRSLPWLIRALLDHISNKITTLEPMISGLQEALPKSIGLLSFDGGVTGCMKLIREQLNWGTKSELKSEVLRGIKEIGSVIYTMGLLDIVLREVDTKRFMQTAPWLGLIPGAEGQIVNAQDGESPLVNLLKSATSAVVSSPGCLNPAAFYTMSKQAEAADLLYKANMNGGSVLEYTLAFTSASLDKYCSKWSAPPKTGFVDITTSKDFYRIYGGLQIGYLEEITAPQSAQHEVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTHRNPQIHQGWEGLLEGMKKARRLNNHVFSMLKARCPLEDKTACAIKQSGAPLPRVRFENTVSAFETLPQKGTVG DIP protein Q5S2C3 original sequence version: 25 3755F9E5D025D55E rac8_arath Rac-like GTP-binding protein ARAC8 ARAC8 ROP10 GTPase protein ROP10 T17F15.90 At3g48040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVLVGTKMDLREDRHYLSDHPGLSPVTTSQGEELRKHIGATYYIECSSKTQQNVKAVFDAAIKVVIKPAVKQKEKKKKQKPRSGCLSNILCGKN DIP protein Q9SU67 original sequence version: 44 4029C5063A936CD4 rac1_arath Rac-like GTP-binding protein ARAC1 ARAC1 ATGP2 ROP3 T17A5.14 At2g17800 GTPase protein ROP3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQPPKQKKKKSKAQKACSIL DIP protein Q38902 original sequence version: 66 spk1_arath Guanine nucleotide exchange factor SPIKE 1 SPK1 FCAALL.346 dl4200c At4g16340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNNLGLRFRKLPRQPLALPKLDPLLDENLEQWPHLNQLVQCYGTEWVKDVNKYGHYENIRPDSFQTQIFEGPDTDTETEIRLASARSATIEEDVASISGRPFSDPGSSKHFGQPPLPAYEPAFDWENERAMIFGQRTPESPAASYSSGLKISVRVLSLAFQSGLVEPFFGSIALYNQERKEKLSEDFYFQIQPTEMQDAKLSSENRGVFYLDAPSASVCLLIQLEKTATEEGGVTSSVYSRKEPVHLTEREKQKLQVWSRIMPYRESFAWAVVPLFDNNLTTNTGESASPSSPLAPSMTASSSHDGVYEPIAKITSDGKQGYSGGSSVVVEISNLNKVKESYSEESIQDPKRKVHKPVKGVLRLEIEKHRNGHGDFEDLSENGSIINDSLDPTDRLSDLTLMKCPSSSSGGPRNGCSKWNSEDAKDVSRNLTSSCGTPDLNCYHAFDFCSTTRNEPFLHLFHCLYVYPVAVTLSRKRNPFIRVELRKDDTDIRKQPLEAIYPREPGVSLQKWVHTQVAVGARAASYHDEIKVSLPATWTPSHHLLFTFFHVDLQTKLEAPRPVVVGYASLPLSTYIHSRSDISLPVMRELVPHYLQESTKERLDYLEDGKNIFKLRLRLCSSLYPTNERVRDFCLEYDRHTLQTRPPWGSELLQAINSLKHVDSTALLQFLYPILNMLLHLIGNGGETLQVAAFRAMVDILTRVQQVSFDDADRNRFLVTYVDYSFDDFGGNQPPVYPGLATVWGSLARSKAKGYRVGPVYDDVLSMAWFFLELIVKSMALEQARLYDHNLPTGEDVPPMQLKESVFRCIMQLFDCLLTEVHERCKKGLSLAKRLNSSLAFFCYDLLYIIEPCQVYELVSLYMDKFSGVCQSVLHECKLTFLQIISDHDLFVEMPGRDPSDRNYLSSILIQELFLSLDHDELPLRAKGARILVILLCKHEFDARYQKAEDKLYIAQLYFPFVGQILDEMPVFYNLNATEKREVLIGVLQIVRNLDDTSLVKAWQQSIARTRLYFKLMEECLILFEHKKAADSILGGNNSRGPVSEGAGSPKYSERLSPAINNYLSEASRQEVRLEGTPDNGYLWQRVNSQLASPSQPYSLREALAQAQSSRIGASAQALRESLHPILRQKLELWEENVSATVSLQVLEITENFSSMAASHNIATDYGKLDCITTILTSFFSRNQSLAFWKAFFPIFNRIFDLHGATLMARENDRFLKQIAFHLLRLAVYRNDSVRKRAVIGLQILVKSSLYFMQTARLRALLTITLSELMSDVQVTHMKSDNTLEESGEARRLQQSLSEMADEAKSVNLLRECGLPDDTLLIIPEKFTENRWSWAEVKHLSDSLVLALDASLGHALLGSVMAMDRYAAAESFYKLGMAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVARNDGVWSKDHVSALRKICPMVSGEFTTEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCASILELVIPVYKSRKAYGQLAKCHTLLTNIYESILDQESNPIPFIDATYYRVGFYGEKFGKLDRKEYVYREPRDVRLGDIMEKLSHIYESRMDSNHILHIIPDSRQVKAEDLQAGVCYLQITAVDAVMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEGSFPALVNRLLVTKSESLEFSPVENAIGMIETRTTALRNELEEPRSSDGDHLPRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL DIP protein Q8SAB7 original sequence version: 20 18CD66FB9B328A1F rac4_arath Rac-like GTP-binding protein ARAC4 ARAC4 ROP2 T20H2.12 At1g20090 GTPase protein ROP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCAFL DIP protein Q38919 original sequence version: 65 DIP protein Q38919 original sequence version: 88 90899399AB7EA658 rac3_arath Rac-like GTP-binding protein ARAC3 ARAC3 RAC1 ROP6 M4E13.80 At4g35020 GTPase protein ROP6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQPPKNKKKKKRKSQKGCSIL DIP protein Q38912 original sequence version: 66 154A01D1AAE3A766 arac4-spk1-1 3 15 unspecified role unspecified role prey prey 966-1830 binding site 966-1830 binding site required to bind necessary binding region required to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 16 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association arac4-spk1-2 1 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 16 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction arac1-spk1-1 2 14 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction arac6-spk1-1 5 11 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction pir-arac1-1 4 17 unspecified role unspecified role prey prey GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 14 unspecified role unspecified role prey prey GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role bait bait his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress association association spk1-nap1-1 8 10 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 15 unspecified role unspecified role bait bait arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association arac5-spk1-1 7 9 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction arac8-spk1-1 6 13 unspecified role unspecified role bait bait GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction