DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cyclin A and the retinoblastoma gene product complex with a common transcription factor. Cyclin A and the retinoblastoma gene product complex with a common transcription factor. Nature 1991 imex curation Bandara LR., Adamczewski JP., Hunt T., La Thangue NB. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift predetermined predetermined participant predetermined Bandara LR., Adamczewski JP., Hunt T., La Thangue NB. DIP original experiment: DIP-264591X Nature 1991 IMEx Cyclin A and the retinoblastoma gene product complex with a common transcription factor. Cyclin A and the retinoblastoma gene product complex with a common transcription factor. Cyclin A and the retinoblastoma gene product complex with a common transcription factor. Nature 1991 imex curation Bandara LR., Adamczewski JP., Hunt T., La Thangue NB. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift predetermined predetermined participant predetermined Bandara LR., Adamczewski JP., Hunt T., La Thangue NB. DIP original experiment: DIP-264590X Nature 1991 IMEx Cyclin A and the retinoblastoma gene product complex with a common transcription factor. tfdp1_mouse Transcription factor Dp-1 Tfdp1 E2F dimerization partner 1 DRTF1-polypeptide 1 protein protein mouse Mus musculus Mouse MAKDASLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVIGTPQRPAASNTIVVGSPHTPNTHFVSQNQTSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRQAEQQARRPPPPNSVIHLPFIIVNTSRKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMGMACGLESGNCSAEDLKVARSLVPKALEPYVTEMAQGSIGGVFVTTTGSTSNGTRLSASDLSNGADGMLATSSNGSQYSGSRVETPVSYVGEDDDDDDDFNENDEED DIP protein Q08639 original sequence version: 128 FEEA090C781071B9 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 ccna2_bovin Cyclin-A2 CCNA2 protein protein bovin Bos taurus (Bovine) Bovine MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGPAPQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV DIP protein P30274 original sequence version: 127 DIP protein P30274 original sequence version: 107 rb1-tfdp1-1 2 3 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 4 unspecified role unspecified role unspecified role unspecified role 379-928 Binding Region 379-928 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association ccna2-rb1-1 1 5 unspecified role unspecified role unspecified role unspecified role 75-430 Binding Region 75-430 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role mouse Mus musculus Mouse 4 unspecified role unspecified role unspecified role unspecified role 379-928 Binding Region 379-928 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association